data_2RPR # _entry.id 2RPR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RPR pdb_00002rpr 10.2210/pdb2rpr/pdb RCSB RCSB150137 ? ? WWPDB D_1000150137 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RPR _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-07-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Enomoto, M.' 1 'Saito, K.' 2 'Tochio, N.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'Nameki, N.' 6 # _citation.id primary _citation.title 'Solution structure of the fifth FLYWCH domain of FLYWCH-type zinc finger-containing protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Enomoto, M.' 1 ? primary 'Saito, K.' 2 ? primary 'Tochio, N.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? primary 'Nameki, N.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'FLYWCH-type zinc finger-containing protein 1' 9977.562 1 ? ? 'FLYWCH-type 5, UNP residues 595-674' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGLRPLEFLRTSLGGRFLVHESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGHRIMVMRSHCHQPDLAGLEA LRQRERL ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGLRPLEFLRTSLGGRFLVHESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGHRIMVMRSHCHQPDLAGLEA LRQRERL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 ARG n 1 10 PRO n 1 11 LEU n 1 12 GLU n 1 13 PHE n 1 14 LEU n 1 15 ARG n 1 16 THR n 1 17 SER n 1 18 LEU n 1 19 GLY n 1 20 GLY n 1 21 ARG n 1 22 PHE n 1 23 LEU n 1 24 VAL n 1 25 HIS n 1 26 GLU n 1 27 SER n 1 28 PHE n 1 29 LEU n 1 30 TYR n 1 31 ARG n 1 32 LYS n 1 33 GLU n 1 34 LYS n 1 35 ALA n 1 36 ALA n 1 37 GLY n 1 38 GLU n 1 39 LYS n 1 40 VAL n 1 41 TYR n 1 42 TRP n 1 43 MET n 1 44 CYS n 1 45 ARG n 1 46 ASP n 1 47 GLN n 1 48 ALA n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 CYS n 1 53 ARG n 1 54 SER n 1 55 ARG n 1 56 ALA n 1 57 ILE n 1 58 THR n 1 59 GLN n 1 60 GLY n 1 61 HIS n 1 62 ARG n 1 63 ILE n 1 64 MET n 1 65 VAL n 1 66 MET n 1 67 ARG n 1 68 SER n 1 69 HIS n 1 70 CYS n 1 71 HIS n 1 72 GLN n 1 73 PRO n 1 74 ASP n 1 75 LEU n 1 76 ALA n 1 77 GLY n 1 78 LEU n 1 79 GLU n 1 80 ALA n 1 81 LEU n 1 82 ARG n 1 83 GLN n 1 84 ARG n 1 85 GLU n 1 86 ARG n 1 87 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FLYWCH1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'CELL-FREE SYNTHESIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector P060116-06 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FWCH1_HUMAN _struct_ref.pdbx_db_accession Q4VC44 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LRPLEFLRTSLGGRFLVHESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGHRIMVMRSHCHQPDLAGLEALRQRERL ; _struct_ref.pdbx_align_begin 595 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RPR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q4VC44 _struct_ref_seq.db_align_beg 595 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 674 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RPR GLY A 1 ? UNP Q4VC44 ? ? 'expression tag' 1 1 1 2RPR SER A 2 ? UNP Q4VC44 ? ? 'expression tag' 2 2 1 2RPR SER A 3 ? UNP Q4VC44 ? ? 'expression tag' 3 3 1 2RPR GLY A 4 ? UNP Q4VC44 ? ? 'expression tag' 4 4 1 2RPR SER A 5 ? UNP Q4VC44 ? ? 'expression tag' 5 5 1 2RPR SER A 6 ? UNP Q4VC44 ? ? 'expression tag' 6 6 1 2RPR GLY A 7 ? UNP Q4VC44 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.3 mM FLYWCH_domain, 0.05 mM ZINC ION, 20 mM d-Tris-HCl(pH7.0), 100 mM NaCl, 1 mM d-DTT, 0.02 % NaN3, 10% D2O, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2RPR _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RPR _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RPR _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Bruker Biospin' collection XwinNMR ? 3 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 4 'Kobayashi, N.' 'data analysis' KUJIRA ? 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RPR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RPR _struct.title 'Solution structure of the fifth FLYWCH domain of FLYWCH-type zinc finger-containing protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RPR _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'FLYWCH domain, Alternative splicing, DNA-binding, Metal-binding, Nucleus, Zinc, Zinc-finger, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 46 ? ALA A 48 ? ASP A 46 ALA A 48 5 ? 3 HELX_P HELX_P2 2 ASP A 74 ? ARG A 84 ? ASP A 74 ARG A 84 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 44 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 44 A ZN 201 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc2 metalc ? ? A CYS 52 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 52 A ZN 201 1_555 ? ? ? ? ? ? ? 2.281 ? ? metalc3 metalc ? ? A HIS 69 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 69 A ZN 201 1_555 ? ? ? ? ? ? ? 2.099 ? ? metalc4 metalc ? ? A HIS 71 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 71 A ZN 201 1_555 ? ? ? ? ? ? ? 2.099 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 12 ? THR A 16 ? GLU A 12 THR A 16 A 2 GLY A 20 ? HIS A 25 ? GLY A 20 HIS A 25 A 3 PHE A 28 ? ALA A 35 ? PHE A 28 ALA A 35 A 4 VAL A 40 ? CYS A 44 ? VAL A 40 CYS A 44 A 5 ARG A 55 ? GLN A 59 ? ARG A 55 GLN A 59 A 6 ARG A 62 ? VAL A 65 ? ARG A 62 VAL A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 14 ? N LEU A 14 O PHE A 22 ? O PHE A 22 A 2 3 N LEU A 23 ? N LEU A 23 O TYR A 30 ? O TYR A 30 A 3 4 N GLU A 33 ? N GLU A 33 O TYR A 41 ? O TYR A 41 A 4 5 N TRP A 42 ? N TRP A 42 O ALA A 56 ? O ALA A 56 A 5 6 N ILE A 57 ? N ILE A 57 O MET A 64 ? O MET A 64 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 PHE A 28 ? PHE A 28 . ? 1_555 ? 2 AC1 5 CYS A 44 ? CYS A 44 . ? 1_555 ? 3 AC1 5 ASP A 46 ? ASP A 46 . ? 1_555 ? 4 AC1 5 CYS A 52 ? CYS A 52 . ? 1_555 ? 5 AC1 5 HIS A 69 ? HIS A 69 . ? 1_555 ? # _atom_sites.entry_id 2RPR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 LEU 87 87 87 LEU LEU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 52 ? A CYS 52 ? 1_555 106.3 ? 2 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 69 ? A HIS 69 ? 1_555 100.6 ? 3 SG ? A CYS 52 ? A CYS 52 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 69 ? A HIS 69 ? 1_555 110.0 ? 4 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 71 ? A HIS 71 ? 1_555 90.6 ? 5 SG ? A CYS 52 ? A CYS 52 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 71 ? A HIS 71 ? 1_555 98.2 ? 6 ND1 ? A HIS 69 ? A HIS 69 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 71 ? A HIS 71 ? 1_555 145.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-08-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id FLYWCH_domain 1.3 mM ? 1 'ZINC ION' 0.05 mM ? 1 'd-Tris-HCl(pH7.0)' 20 mM ? 1 NaCl 100 mM ? 1 d-DTT 1 mM ? 1 NaN3 0.02 % ? 1 D2O 10 % ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 10 ? ? -69.85 -172.33 2 1 SER A 17 ? ? -54.13 -174.02 3 1 LEU A 18 ? ? -34.56 101.86 4 1 ALA A 36 ? ? -88.85 32.68 5 1 CYS A 44 ? ? -50.16 109.60 6 1 ASP A 46 ? ? -85.47 30.86 7 1 ARG A 49 ? ? -96.70 -60.56 8 2 LEU A 8 ? ? -175.11 141.40 9 2 PRO A 10 ? ? -69.73 -165.20 10 2 LEU A 18 ? ? 41.25 28.17 11 2 SER A 27 ? ? 56.05 19.94 12 2 ALA A 36 ? ? -82.54 38.01 13 2 CYS A 44 ? ? -46.10 108.46 14 2 ASP A 46 ? ? -81.39 42.06 15 2 MET A 66 ? ? -93.87 -65.10 16 3 SER A 2 ? ? -90.65 36.24 17 3 PRO A 10 ? ? -69.80 -163.83 18 4 PRO A 10 ? ? -69.77 -169.02 19 4 ASP A 46 ? ? -88.26 32.06 20 4 MET A 66 ? ? -103.40 -62.25 21 4 GLU A 85 ? ? -92.28 -64.15 22 5 PRO A 10 ? ? -69.72 -166.71 23 5 SER A 17 ? ? -34.79 -75.92 24 5 ASP A 46 ? ? -85.47 48.19 25 5 ARG A 53 ? ? -105.58 50.23 26 6 SER A 3 ? ? -119.58 65.01 27 6 PRO A 10 ? ? -69.79 -165.25 28 6 SER A 17 ? ? -106.73 -68.99 29 6 LEU A 18 ? ? -84.11 36.44 30 6 CYS A 44 ? ? -46.59 107.56 31 6 ASP A 46 ? ? -88.80 40.52 32 6 ARG A 49 ? ? -92.41 -61.93 33 6 CYS A 52 ? ? -105.50 72.86 34 6 SER A 54 ? ? -35.55 122.72 35 7 PRO A 10 ? ? -69.68 -176.10 36 7 CYS A 44 ? ? -46.42 108.39 37 7 ASP A 46 ? ? -84.09 35.79 38 7 ARG A 86 ? ? -103.55 73.41 39 8 LEU A 18 ? ? -68.24 71.15 40 8 LYS A 32 ? ? -45.18 108.58 41 8 ASP A 46 ? ? -79.69 44.31 42 9 PRO A 10 ? ? -69.70 -179.50 43 9 CYS A 44 ? ? -38.16 114.11 44 9 ASP A 46 ? ? -85.56 43.32 45 9 MET A 66 ? ? -102.46 -62.82 46 9 GLU A 85 ? ? -98.01 -72.26 47 10 LEU A 8 ? ? -34.28 143.97 48 10 PRO A 10 ? ? -69.82 -167.89 49 10 LEU A 18 ? ? -101.84 70.87 50 10 ASP A 46 ? ? -83.33 36.60 51 10 ARG A 49 ? ? -98.79 -62.12 52 10 ASP A 74 ? ? -114.37 75.67 53 10 LEU A 75 ? ? -49.56 -19.76 54 10 GLU A 85 ? ? -82.51 -72.77 55 11 SER A 5 ? ? -127.77 -61.31 56 11 PRO A 10 ? ? -69.80 -178.45 57 11 CYS A 44 ? ? -44.35 106.48 58 11 ASP A 46 ? ? -85.31 31.31 59 11 SER A 68 ? ? -69.25 -179.60 60 12 PRO A 10 ? ? -69.78 -164.93 61 12 ASP A 46 ? ? -83.54 36.44 62 12 SER A 54 ? ? -39.32 128.26 63 12 MET A 66 ? ? -104.77 -61.04 64 13 SER A 2 ? ? 34.52 34.28 65 13 PRO A 10 ? ? -69.76 -176.36 66 13 LEU A 18 ? ? -80.65 42.50 67 13 ARG A 49 ? ? -98.38 -62.51 68 14 ARG A 49 ? ? -93.54 -62.75 69 14 ARG A 53 ? ? -81.91 45.61 70 14 MET A 66 ? ? -93.56 -63.43 71 14 ASP A 74 ? ? -101.27 79.35 72 15 LEU A 8 ? ? -160.97 108.41 73 15 PRO A 10 ? ? -69.73 -174.77 74 15 ALA A 36 ? ? -87.27 38.16 75 15 CYS A 44 ? ? -55.13 108.93 76 15 ARG A 45 ? ? -39.98 -30.14 77 15 MET A 66 ? ? -104.67 -61.61 78 16 LEU A 8 ? ? -35.08 96.90 79 17 PRO A 10 ? ? -69.75 -169.89 80 17 LEU A 18 ? ? -112.84 64.03 81 17 ALA A 36 ? ? -109.82 69.14 82 17 ASP A 46 ? ? -82.82 45.49 83 17 MET A 66 ? ? -105.59 -61.93 84 17 SER A 68 ? ? -68.73 -175.50 85 17 ARG A 86 ? ? -90.57 52.52 86 18 PRO A 10 ? ? -69.76 -171.06 87 18 ALA A 36 ? ? -95.30 34.73 88 18 CYS A 44 ? ? -51.06 106.55 89 19 PRO A 10 ? ? -69.82 -170.78 90 19 CYS A 44 ? ? -51.30 104.97 91 19 ASP A 46 ? ? -87.86 48.49 92 19 SER A 54 ? ? -40.82 105.14 93 20 SER A 2 ? ? -50.50 95.38 94 20 PRO A 10 ? ? -69.75 -170.04 95 20 CYS A 44 ? ? -52.85 107.58 96 20 ASP A 46 ? ? -81.96 43.92 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #