data_2RQH # _entry.id 2RQH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2RQH RCSB RCSB150163 WWPDB D_1000150163 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 7033 . unspecified PDB 2RQG . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RQH _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-05-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Osawa, M.' 1 'Nakanishi, T.' 2 'Hosoda, N.' 3 'Uchida, S.' 4 'Hoshino, T.' 5 'Katada, I.' 6 'Shimada, I.' 7 # _citation.id primary _citation.title 'Eukaryotic Translation Termination Factor Gspt/Erf3 Recognizes Pabp with Chemical Exchange Using Two Overlapping Motifs' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Osawa, M.' 1 primary 'Nakanishi, T.' 2 primary 'Hosoda, N.' 3 primary 'Uchida, S.' 4 primary 'Hoshino, T.' 5 primary 'Katada, I.' 6 primary 'Shimada, I.' 7 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'G1 to S phase transition 1' 2354.724 1 ? ? 'RESIDUES 73-94 (UNP residues 24-45)' ? 2 polymer man 'Polyadenylate-binding protein 1' 8996.363 1 ? ? 'PABC DOMAIN' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'GSPT1/eRF3a PAM2-1' 2 'Poly(A)-binding protein 1, PABP 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no AKPFVPNVHAAEFVPSFLRGPA AKPFVPNVHAAEFVPSFLRGPA A ? 2 'polypeptide(L)' no no ;GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAK EAA ; ;GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAK EAA ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LYS n 1 3 PRO n 1 4 PHE n 1 5 VAL n 1 6 PRO n 1 7 ASN n 1 8 VAL n 1 9 HIS n 1 10 ALA n 1 11 ALA n 1 12 GLU n 1 13 PHE n 1 14 VAL n 1 15 PRO n 1 16 SER n 1 17 PHE n 1 18 LEU n 1 19 ARG n 1 20 GLY n 1 21 PRO n 1 22 ALA n 2 1 GLY n 2 2 GLN n 2 3 GLU n 2 4 PRO n 2 5 LEU n 2 6 THR n 2 7 ALA n 2 8 SER n 2 9 MET n 2 10 LEU n 2 11 ALA n 2 12 SER n 2 13 ALA n 2 14 PRO n 2 15 PRO n 2 16 GLN n 2 17 GLU n 2 18 GLN n 2 19 LYS n 2 20 GLN n 2 21 MET n 2 22 LEU n 2 23 GLY n 2 24 GLU n 2 25 ARG n 2 26 LEU n 2 27 PHE n 2 28 PRO n 2 29 LEU n 2 30 ILE n 2 31 GLN n 2 32 ALA n 2 33 MET n 2 34 HIS n 2 35 PRO n 2 36 THR n 2 37 LEU n 2 38 ALA n 2 39 GLY n 2 40 LYS n 2 41 ILE n 2 42 THR n 2 43 GLY n 2 44 MET n 2 45 LEU n 2 46 LEU n 2 47 GLU n 2 48 ILE n 2 49 ASP n 2 50 ASN n 2 51 SER n 2 52 GLU n 2 53 LEU n 2 54 LEU n 2 55 HIS n 2 56 MET n 2 57 LEU n 2 58 GLU n 2 59 SER n 2 60 PRO n 2 61 GLU n 2 62 SER n 2 63 LEU n 2 64 ARG n 2 65 SER n 2 66 LYS n 2 67 VAL n 2 68 ASP n 2 69 GLU n 2 70 ALA n 2 71 VAL n 2 72 ALA n 2 73 VAL n 2 74 LEU n 2 75 GLN n 2 76 ALA n 2 77 HIS n 2 78 GLN n 2 79 ALA n 2 80 LYS n 2 81 GLU n 2 82 ALA n 2 83 ALA n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? mouse ? Gspt1 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pGEX6p-1 ? ? ? ? ? 2 1 sample ? ? ? human ? 'PABPC1, PAB1, PABP1, PABPC2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pET42b ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP Q8K2E1_MOUSE Q8K2E1 1 AKPFVPNVHAAEFVPSFLRGPA 24 ? 2 UNP PABP1_HUMAN P11940 2 ;GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAK EAA ; 541 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2RQH A 1 ? 22 ? Q8K2E1 24 ? 45 ? 73 94 2 2 2RQH B 1 ? 83 ? P11940 541 ? 623 ? 541 623 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-SEPARATED_NOESY 1 2 1 '3D_ 13C-SEPARATED_NOESY' 1 3 1 HNHA 1 4 1 '13C -FILTERD/13C-EDITED NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15M _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM G1 TO S PHASE TRANSITION 1-1, 1 mM [U-98% 13C; U-98% 15N] POLYADENYLATE-BINDING PROTEIN 1-2, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'BRUKER AVANCE' # _pdbx_nmr_refine.entry_id 2RQH _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RQH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RQH _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Goddard 'chemical shift assignment' SPARKY 3 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 2 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RQH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RQH _struct.title 'Structure of GSPT1/ERF3A-PABC' _struct.pdbx_descriptor 'G1 to S phase transition 1, Polyadenylate-binding protein 1' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RQH _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;PROTEIN-PROTEIN COMPLEX, GTP-binding, Nucleotide-binding, Alternative splicing, Cytoplasm, Methylation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, RNA-binding, Spliceosome, PROTEIN BINDING ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR B 6 ? ALA B 13 ? THR B 546 ALA B 553 1 ? 8 HELX_P HELX_P2 2 PRO B 14 ? ALA B 32 ? PRO B 554 ALA B 572 1 ? 19 HELX_P HELX_P3 3 MET B 33 ? THR B 36 ? MET B 573 THR B 576 5 ? 4 HELX_P HELX_P4 4 LEU B 37 ? ILE B 48 ? LEU B 577 ILE B 588 1 ? 12 HELX_P HELX_P5 5 ASP B 49 ? LEU B 57 ? ASP B 589 LEU B 597 1 ? 9 HELX_P HELX_P6 6 SER B 59 ? GLN B 78 ? SER B 599 GLN B 618 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2RQH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 73 73 ALA ALA A . n A 1 2 LYS 2 74 74 LYS LYS A . n A 1 3 PRO 3 75 75 PRO PRO A . n A 1 4 PHE 4 76 76 PHE PHE A . n A 1 5 VAL 5 77 77 VAL VAL A . n A 1 6 PRO 6 78 78 PRO PRO A . n A 1 7 ASN 7 79 79 ASN ASN A . n A 1 8 VAL 8 80 80 VAL VAL A . n A 1 9 HIS 9 81 81 HIS HIS A . n A 1 10 ALA 10 82 82 ALA ALA A . n A 1 11 ALA 11 83 83 ALA ALA A . n A 1 12 GLU 12 84 84 GLU GLU A . n A 1 13 PHE 13 85 85 PHE PHE A . n A 1 14 VAL 14 86 86 VAL VAL A . n A 1 15 PRO 15 87 87 PRO PRO A . n A 1 16 SER 16 88 88 SER SER A . n A 1 17 PHE 17 89 89 PHE PHE A . n A 1 18 LEU 18 90 90 LEU LEU A . n A 1 19 ARG 19 91 91 ARG ARG A . n A 1 20 GLY 20 92 92 GLY GLY A . n A 1 21 PRO 21 93 93 PRO PRO A . n A 1 22 ALA 22 94 94 ALA ALA A . n B 2 1 GLY 1 541 541 GLY GLY B . n B 2 2 GLN 2 542 542 GLN GLN B . n B 2 3 GLU 3 543 543 GLU GLU B . n B 2 4 PRO 4 544 544 PRO PRO B . n B 2 5 LEU 5 545 545 LEU LEU B . n B 2 6 THR 6 546 546 THR THR B . n B 2 7 ALA 7 547 547 ALA ALA B . n B 2 8 SER 8 548 548 SER SER B . n B 2 9 MET 9 549 549 MET MET B . n B 2 10 LEU 10 550 550 LEU LEU B . n B 2 11 ALA 11 551 551 ALA ALA B . n B 2 12 SER 12 552 552 SER SER B . n B 2 13 ALA 13 553 553 ALA ALA B . n B 2 14 PRO 14 554 554 PRO PRO B . n B 2 15 PRO 15 555 555 PRO PRO B . n B 2 16 GLN 16 556 556 GLN GLN B . n B 2 17 GLU 17 557 557 GLU GLU B . n B 2 18 GLN 18 558 558 GLN GLN B . n B 2 19 LYS 19 559 559 LYS LYS B . n B 2 20 GLN 20 560 560 GLN GLN B . n B 2 21 MET 21 561 561 MET MET B . n B 2 22 LEU 22 562 562 LEU LEU B . n B 2 23 GLY 23 563 563 GLY GLY B . n B 2 24 GLU 24 564 564 GLU GLU B . n B 2 25 ARG 25 565 565 ARG ARG B . n B 2 26 LEU 26 566 566 LEU LEU B . n B 2 27 PHE 27 567 567 PHE PHE B . n B 2 28 PRO 28 568 568 PRO PRO B . n B 2 29 LEU 29 569 569 LEU LEU B . n B 2 30 ILE 30 570 570 ILE ILE B . n B 2 31 GLN 31 571 571 GLN GLN B . n B 2 32 ALA 32 572 572 ALA ALA B . n B 2 33 MET 33 573 573 MET MET B . n B 2 34 HIS 34 574 574 HIS HIS B . n B 2 35 PRO 35 575 575 PRO PRO B . n B 2 36 THR 36 576 576 THR THR B . n B 2 37 LEU 37 577 577 LEU LEU B . n B 2 38 ALA 38 578 578 ALA ALA B . n B 2 39 GLY 39 579 579 GLY GLY B . n B 2 40 LYS 40 580 580 LYS LYS B . n B 2 41 ILE 41 581 581 ILE ILE B . n B 2 42 THR 42 582 582 THR THR B . n B 2 43 GLY 43 583 583 GLY GLY B . n B 2 44 MET 44 584 584 MET MET B . n B 2 45 LEU 45 585 585 LEU LEU B . n B 2 46 LEU 46 586 586 LEU LEU B . n B 2 47 GLU 47 587 587 GLU GLU B . n B 2 48 ILE 48 588 588 ILE ILE B . n B 2 49 ASP 49 589 589 ASP ASP B . n B 2 50 ASN 50 590 590 ASN ASN B . n B 2 51 SER 51 591 591 SER SER B . n B 2 52 GLU 52 592 592 GLU GLU B . n B 2 53 LEU 53 593 593 LEU LEU B . n B 2 54 LEU 54 594 594 LEU LEU B . n B 2 55 HIS 55 595 595 HIS HIS B . n B 2 56 MET 56 596 596 MET MET B . n B 2 57 LEU 57 597 597 LEU LEU B . n B 2 58 GLU 58 598 598 GLU GLU B . n B 2 59 SER 59 599 599 SER SER B . n B 2 60 PRO 60 600 600 PRO PRO B . n B 2 61 GLU 61 601 601 GLU GLU B . n B 2 62 SER 62 602 602 SER SER B . n B 2 63 LEU 63 603 603 LEU LEU B . n B 2 64 ARG 64 604 604 ARG ARG B . n B 2 65 SER 65 605 605 SER SER B . n B 2 66 LYS 66 606 606 LYS LYS B . n B 2 67 VAL 67 607 607 VAL VAL B . n B 2 68 ASP 68 608 608 ASP ASP B . n B 2 69 GLU 69 609 609 GLU GLU B . n B 2 70 ALA 70 610 610 ALA ALA B . n B 2 71 VAL 71 611 611 VAL VAL B . n B 2 72 ALA 72 612 612 ALA ALA B . n B 2 73 VAL 73 613 613 VAL VAL B . n B 2 74 LEU 74 614 614 LEU LEU B . n B 2 75 GLN 75 615 615 GLN GLN B . n B 2 76 ALA 76 616 616 ALA ALA B . n B 2 77 HIS 77 617 617 HIS HIS B . n B 2 78 GLN 78 618 618 GLN GLN B . n B 2 79 ALA 79 619 619 ALA ALA B . n B 2 80 LYS 80 620 620 LYS LYS B . n B 2 81 GLU 81 621 621 GLU GLU B . n B 2 82 ALA 82 622 622 ALA ALA B . n B 2 83 ALA 83 623 623 ALA ALA B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-05-26 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'G1 TO S PHASE TRANSITION 1-1' 1 ? mM ? 1 'POLYADENYLATE-BINDING PROTEIN 1-2' 1 ? mM '[U-98% 13C; U-98% 15N]' 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 74 ? ? 60.35 73.09 2 1 VAL A 77 ? ? 36.00 78.71 3 1 LEU A 90 ? ? 57.51 95.40 4 1 PRO B 544 ? ? -69.80 -172.10 5 1 ASP B 589 ? ? 176.81 130.77 6 1 GLU B 621 ? ? -104.84 60.22 7 2 LYS A 74 ? ? -166.96 70.11 8 2 VAL A 77 ? ? -112.46 76.18 9 2 PRO A 87 ? ? -69.75 -170.33 10 2 PRO B 544 ? ? -69.75 -169.71 11 2 MET B 573 ? ? -139.20 -59.81 12 2 LEU B 577 ? ? -141.26 30.62 13 2 ASP B 589 ? ? 175.65 126.99 14 2 GLN B 618 ? ? -153.93 -63.31 15 2 ALA B 622 ? ? -76.54 -73.18 16 3 VAL A 77 ? ? -112.84 75.56 17 3 ALA A 82 ? ? -108.00 -168.99 18 3 PRO B 544 ? ? -69.78 -176.36 19 3 LEU B 577 ? ? -141.89 34.64 20 3 ASP B 589 ? ? 175.86 128.03 21 3 SER B 599 ? ? -114.80 78.41 22 3 ALA B 616 ? ? -94.23 32.35 23 3 ALA B 619 ? ? -176.41 -176.55 24 4 VAL A 77 ? ? -113.37 73.56 25 4 PRO A 87 ? ? -69.83 -170.47 26 4 PRO A 93 ? ? -69.73 -171.54 27 4 GLU B 543 ? ? 62.88 160.30 28 4 PRO B 544 ? ? -69.77 -178.19 29 4 ASP B 589 ? ? 176.81 126.43 30 4 ALA B 622 ? ? -98.42 48.75 31 5 VAL A 77 ? ? -113.14 73.61 32 5 PRO B 544 ? ? -69.82 -178.80 33 5 LYS B 559 ? ? -68.64 -71.89 34 5 MET B 573 ? ? -124.26 -57.80 35 5 ASP B 589 ? ? 175.51 130.33 36 6 VAL A 77 ? ? -112.43 75.92 37 6 VAL A 86 ? ? 65.54 148.94 38 6 PRO A 87 ? ? -69.79 82.33 39 6 PRO B 544 ? ? -69.80 -173.55 40 6 LEU B 577 ? ? -141.08 34.57 41 6 ASP B 589 ? ? 175.33 131.33 42 7 LYS A 74 ? ? 58.17 71.19 43 7 VAL A 77 ? ? -113.83 72.43 44 7 VAL A 86 ? ? 178.69 149.25 45 7 LEU A 90 ? ? -103.90 -64.48 46 7 PRO A 93 ? ? -69.71 -170.93 47 7 PRO B 544 ? ? -69.76 -178.32 48 7 MET B 573 ? ? -125.55 -57.27 49 7 LEU B 577 ? ? -141.16 36.68 50 7 ASP B 589 ? ? 178.34 124.28 51 7 GLN B 618 ? ? -135.80 -58.07 52 8 LYS A 74 ? ? -163.21 69.56 53 8 VAL A 77 ? ? -113.70 72.68 54 8 ALA A 82 ? ? -103.69 -169.52 55 8 PRO B 544 ? ? -69.81 -179.21 56 8 ASP B 589 ? ? 177.67 127.73 57 8 SER B 599 ? ? -114.00 79.64 58 8 HIS B 617 ? ? -58.11 -71.84 59 9 LYS A 74 ? ? 60.12 73.72 60 9 VAL A 77 ? ? 68.56 65.70 61 9 ALA A 82 ? ? -107.74 -169.11 62 9 SER A 88 ? ? -119.42 75.18 63 9 ARG A 91 ? ? -59.91 178.19 64 9 PRO B 544 ? ? -69.80 -178.46 65 9 LEU B 577 ? ? -140.98 33.35 66 9 ASP B 589 ? ? 178.14 123.92 67 9 LYS B 620 ? ? -170.09 129.10 68 10 VAL A 77 ? ? 67.95 65.52 69 10 ALA A 82 ? ? -110.93 -169.16 70 10 PRO B 544 ? ? -69.76 -174.58 71 10 MET B 573 ? ? -137.07 -59.42 72 10 LEU B 577 ? ? -140.10 34.53 73 10 ASP B 589 ? ? 175.83 129.70 74 10 LYS B 620 ? ? -161.05 112.74 75 11 LYS A 74 ? ? 179.69 -60.84 76 11 PRO A 75 ? ? -69.79 79.05 77 11 VAL A 77 ? ? -110.47 78.52 78 11 PRO A 78 ? ? -69.75 -172.67 79 11 SER A 88 ? ? -153.77 62.28 80 11 PRO A 93 ? ? -69.78 -174.42 81 11 PRO B 544 ? ? -69.78 -178.55 82 11 MET B 573 ? ? -137.64 -58.79 83 11 LEU B 577 ? ? -142.54 29.26 84 11 ASP B 589 ? ? 176.78 127.27 85 12 VAL A 77 ? ? -113.46 73.77 86 12 PRO B 544 ? ? -69.78 -178.16 87 12 MET B 573 ? ? -125.27 -57.68 88 12 LEU B 577 ? ? -142.22 35.85 89 12 ASP B 589 ? ? 177.66 127.93 90 12 GLU B 621 ? ? -120.76 -52.42 91 13 LYS A 74 ? ? -166.87 69.54 92 13 VAL A 77 ? ? -112.53 76.55 93 13 ALA A 82 ? ? -115.95 -168.76 94 13 PHE A 85 ? ? -60.96 -168.69 95 13 VAL A 86 ? ? 37.91 67.06 96 13 PRO A 87 ? ? -69.79 87.04 97 13 LEU A 90 ? ? 58.73 72.73 98 13 ARG A 91 ? ? -48.39 164.28 99 13 PRO B 544 ? ? -69.75 -167.85 100 13 MET B 573 ? ? -125.49 -57.34 101 13 LEU B 577 ? ? -140.01 36.98 102 13 ASP B 589 ? ? 177.39 126.28 103 13 GLN B 618 ? ? -150.89 -51.94 104 14 VAL A 77 ? ? 35.10 70.47 105 14 PRO A 78 ? ? -69.75 -170.48 106 14 ALA A 83 ? ? -54.82 175.15 107 14 VAL A 86 ? ? -179.08 132.56 108 14 PRO A 87 ? ? -69.77 90.37 109 14 PRO B 544 ? ? -69.72 -177.54 110 14 MET B 573 ? ? -137.84 -59.62 111 14 ASP B 589 ? ? 176.63 128.18 112 15 LYS A 74 ? ? -155.95 68.30 113 15 VAL A 77 ? ? -112.33 76.62 114 15 VAL A 86 ? ? -49.95 108.37 115 15 SER A 88 ? ? -57.62 176.03 116 15 PRO B 544 ? ? -69.82 -175.75 117 15 ASP B 589 ? ? 177.35 121.28 118 16 VAL A 77 ? ? -112.36 76.82 119 16 ALA A 82 ? ? -105.14 -169.37 120 16 PRO A 87 ? ? -69.80 99.19 121 16 PRO B 544 ? ? -69.80 -175.45 122 16 MET B 573 ? ? -133.54 -59.56 123 16 ASP B 589 ? ? 176.80 126.39 124 16 ALA B 619 ? ? -173.66 -177.42 125 17 VAL A 77 ? ? 68.27 65.39 126 17 PHE A 89 ? ? -143.28 30.48 127 17 PRO B 544 ? ? -69.75 -173.56 128 17 MET B 573 ? ? -104.70 -61.12 129 17 ASP B 589 ? ? 177.14 126.02 130 18 LYS A 74 ? ? -150.98 69.10 131 18 PRO A 75 ? ? -69.75 -169.97 132 18 VAL A 77 ? ? 67.46 63.91 133 18 ALA A 83 ? ? -58.53 -78.26 134 18 ARG A 91 ? ? -53.09 171.70 135 18 PRO B 544 ? ? -69.76 -173.21 136 18 SER B 552 ? ? -133.17 -40.63 137 18 MET B 573 ? ? -122.72 -57.65 138 18 ASP B 589 ? ? 176.82 128.50 139 18 SER B 599 ? ? -113.65 79.05 140 19 VAL A 77 ? ? -112.69 75.86 141 19 LEU A 90 ? ? -106.24 52.13 142 19 GLU B 543 ? ? 62.40 160.73 143 19 PRO B 544 ? ? -69.79 -176.92 144 19 MET B 573 ? ? -126.07 -56.86 145 19 ASP B 589 ? ? 176.26 127.68 146 19 ALA B 619 ? ? -105.78 51.36 147 20 VAL A 77 ? ? 67.35 64.44 148 20 VAL A 86 ? ? -113.83 77.98 149 20 PRO B 544 ? ? -69.71 -168.20 150 20 MET B 573 ? ? -131.15 -59.78 151 20 LEU B 577 ? ? -142.75 27.38 152 20 ASP B 589 ? ? 175.03 127.64 153 20 ALA B 622 ? ? -106.77 74.57 #