data_2RVN # _entry.id 2RVN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id RCSB150321 RCSB 2RVN PDB 11606 BMRB D_1000150321 WWPDB # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 11606 BMRB unspecified . 2RVL PDB unspecified . 2RVM PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RVN _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-12-18 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kawaguchi, A.' 1 'Nishimura, Y.' 2 # _citation.id primary _citation.title 'Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 6 _citation.page_first 22527 _citation.page_last 22527 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26934956 _citation.pdbx_database_id_DOI 10.1038/srep22527 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Shimojo, H.' 1 primary 'Kawaguchi, A.' 2 primary 'Oda, T.' 3 primary 'Hashiguchi, N.' 4 primary 'Omori, S.' 5 primary 'Moritsugu, K.' 6 primary 'Kidera, A.' 7 primary 'Hiragami-Hamada, K.' 8 primary 'Nakayama, J.' 9 primary 'Sato, M.' 10 primary 'Nishimura, Y.' 11 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chromobox protein homolog 5' 10169.046 1 ? ? 'N-terminal domain, UNP residues 1-80' ? 2 polymer syn '18-mer peptide of Histone H3' 2025.360 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Heterochromatin protein 1 homolog alpha, HP1 alpha' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GSHMGKKTKRTAD(SEP)(SEP)(SEP)(SEP)EDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPE LISEFMKKYKKMKEGENNK ; ;GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGE NNK ; A ? 2 'polypeptide(L)' no yes 'ARTKQTAR(M3L)STGGKAPRY' ARTKQTARKSTGGKAPRY B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 LYS n 1 7 LYS n 1 8 THR n 1 9 LYS n 1 10 ARG n 1 11 THR n 1 12 ALA n 1 13 ASP n 1 14 SEP n 1 15 SEP n 1 16 SEP n 1 17 SEP n 1 18 GLU n 1 19 ASP n 1 20 GLU n 1 21 GLU n 1 22 GLU n 1 23 TYR n 1 24 VAL n 1 25 VAL n 1 26 GLU n 1 27 LYS n 1 28 VAL n 1 29 LEU n 1 30 ASP n 1 31 ARG n 1 32 ARG n 1 33 MET n 1 34 VAL n 1 35 LYS n 1 36 GLY n 1 37 GLN n 1 38 VAL n 1 39 GLU n 1 40 TYR n 1 41 LEU n 1 42 LEU n 1 43 LYS n 1 44 TRP n 1 45 LYS n 1 46 GLY n 1 47 PHE n 1 48 SER n 1 49 GLU n 1 50 GLU n 1 51 HIS n 1 52 ASN n 1 53 THR n 1 54 TRP n 1 55 GLU n 1 56 PRO n 1 57 GLU n 1 58 LYS n 1 59 ASN n 1 60 LEU n 1 61 ASP n 1 62 CYS n 1 63 PRO n 1 64 GLU n 1 65 LEU n 1 66 ILE n 1 67 SER n 1 68 GLU n 1 69 PHE n 1 70 MET n 1 71 LYS n 1 72 LYS n 1 73 TYR n 1 74 LYS n 1 75 LYS n 1 76 MET n 1 77 LYS n 1 78 GLU n 1 79 GLY n 1 80 GLU n 1 81 ASN n 1 82 ASN n 1 83 LYS n 2 1 ALA n 2 2 ARG n 2 3 THR n 2 4 LYS n 2 5 GLN n 2 6 THR n 2 7 ALA n 2 8 ARG n 2 9 M3L n 2 10 SER n 2 11 THR n 2 12 GLY n 2 13 GLY n 2 14 LYS n 2 15 ALA n 2 16 PRO n 2 17 ARG n 2 18 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cbx5, Hp1a' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pCold _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'For phosphorylation of Ser the expression with pRSFduet (CK2)' # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Mus musculus' _pdbx_entity_src_syn.organism_common_name mouse _pdbx_entity_src_syn.ncbi_taxonomy_id 10090 _pdbx_entity_src_syn.details 'synthetic peptide' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP CBX5_MOUSE Q61686 1 ;MGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK ; 1 ? 2 PDB 2RVN 2RVN 2 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2RVN A 4 ? 83 ? Q61686 1 ? 80 ? 1 80 2 2 2RVN B 1 ? 18 ? 2RVN 1 ? 18 ? 1 18 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RVN GLY A 1 ? UNP Q61686 ? ? 'EXPRESSION TAG' -2 1 1 2RVN SER A 2 ? UNP Q61686 ? ? 'EXPRESSION TAG' -1 2 1 2RVN HIS A 3 ? UNP Q61686 ? ? 'EXPRESSION TAG' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC aliphatic' 1 3 2 '2D 1H-13C HSQC aromatic' 1 4 1 '2D 1H-1H TOCSY' 1 5 1 '2D 1H-1H NOESY' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCO' 1 8 1 '3D HNCA' 1 9 1 '3D HNCACB' 1 10 1 '3D HN(CO)CA' 1 11 1 '3D HBHA(CO)NH' 1 12 2 '3D HCCH-TOCSY' 1 13 1 '3D 1H-15N NOESY' 1 14 2 '3D 1H-13C NOESY aliphatic' 1 15 2 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;20 mM [U-99% 13C; U-99% 15N] potassium phosphate-1, 10 mM [U-99% 13C; U-99% 15N] sodium chloride-2, 5 mM [U-99% 13C; U-99% 15N] DTT-3, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;20 mM [U-99% 13C; U-99% 15N] potassium phosphate-4, 10 mM [U-99% 13C; U-99% 15N] sodium chloride-5, 5 mM [U-99% 13C; U-99% 15N] DTT-6, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker Avance 1 'Bruker Avance' 700 Bruker Avance 2 'Bruker Avance' 800 Bruker Avance 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2RVN _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 600 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RVN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RVN _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 1 ? 'Yokochi, M., Sekiguchi, S. and Inagaki, F.' 'chemical shift assignment' Olivia 2 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3 ? ? refinement CYANA 4 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RVN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RVN _struct.title 'Solution structure of the chromodomain of HP1a with the phosphorylated N-terminal tail complexed with H3K9me3 peptide' _struct.pdbx_descriptor 'Chromobox protein homolog 5, 18-mer peptide' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RVN _struct_keywords.pdbx_keywords TRANSCRIPTION/PEPTIDE _struct_keywords.text 'chromodomain, hp1alpha, TRANSCRIPTION-PEPTIDE complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 48 ? ASN A 52 ? SER A 45 ASN A 49 5 ? 5 HELX_P HELX_P2 2 CYS A 62 ? LYS A 77 ? CYS A 59 LYS A 74 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ASP 13 C ? ? ? 1_555 A SEP 14 N ? ? A ASP 10 A SEP 11 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale ? ? A SEP 14 C ? ? ? 1_555 A SEP 15 N ? ? A SEP 11 A SEP 12 1_555 ? ? ? ? ? ? ? 1.325 ? covale3 covale ? ? A SEP 15 C ? ? ? 1_555 A SEP 16 N ? ? A SEP 12 A SEP 13 1_555 ? ? ? ? ? ? ? 1.325 ? covale4 covale ? ? A SEP 16 C ? ? ? 1_555 A SEP 17 N ? ? A SEP 13 A SEP 14 1_555 ? ? ? ? ? ? ? 1.325 ? covale5 covale ? ? A SEP 17 C ? ? ? 1_555 A GLU 18 N ? ? A SEP 14 A GLU 15 1_555 ? ? ? ? ? ? ? 1.330 ? covale6 covale ? ? B ARG 8 C ? ? ? 1_555 B M3L 9 N ? ? B ARG 8 B M3L 9 1_555 ? ? ? ? ? ? ? 1.330 ? covale7 covale ? ? B M3L 9 C ? ? ? 1_555 B SER 10 N ? ? B M3L 9 B SER 10 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 25 ? VAL A 34 ? VAL A 22 VAL A 31 A 2 GLN A 37 ? TRP A 44 ? GLN A 34 TRP A 41 A 3 TRP A 54 ? PRO A 56 ? TRP A 51 PRO A 53 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 34 ? N VAL A 31 O GLN A 37 ? O GLN A 34 A 2 3 N TYR A 40 ? N TYR A 37 O GLU A 55 ? O GLU A 52 # _atom_sites.entry_id 2RVN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 HIS 3 0 0 HIS HIS A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 GLY 5 2 2 GLY GLY A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 LYS 7 4 4 LYS LYS A . n A 1 8 THR 8 5 5 THR THR A . n A 1 9 LYS 9 6 6 LYS LYS A . n A 1 10 ARG 10 7 7 ARG ARG A . n A 1 11 THR 11 8 8 THR THR A . n A 1 12 ALA 12 9 9 ALA ALA A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 SEP 14 11 11 SEP SEP A . n A 1 15 SEP 15 12 12 SEP SEP A . n A 1 16 SEP 16 13 13 SEP SEP A . n A 1 17 SEP 17 14 14 SEP SEP A . n A 1 18 GLU 18 15 15 GLU GLU A . n A 1 19 ASP 19 16 16 ASP ASP A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 GLU 22 19 19 GLU GLU A . n A 1 23 TYR 23 20 20 TYR TYR A . n A 1 24 VAL 24 21 21 VAL VAL A . n A 1 25 VAL 25 22 22 VAL VAL A . n A 1 26 GLU 26 23 23 GLU GLU A . n A 1 27 LYS 27 24 24 LYS LYS A . n A 1 28 VAL 28 25 25 VAL VAL A . n A 1 29 LEU 29 26 26 LEU LEU A . n A 1 30 ASP 30 27 27 ASP ASP A . n A 1 31 ARG 31 28 28 ARG ARG A . n A 1 32 ARG 32 29 29 ARG ARG A . n A 1 33 MET 33 30 30 MET MET A . n A 1 34 VAL 34 31 31 VAL VAL A . n A 1 35 LYS 35 32 32 LYS LYS A . n A 1 36 GLY 36 33 33 GLY GLY A . n A 1 37 GLN 37 34 34 GLN GLN A . n A 1 38 VAL 38 35 35 VAL VAL A . n A 1 39 GLU 39 36 36 GLU GLU A . n A 1 40 TYR 40 37 37 TYR TYR A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 LEU 42 39 39 LEU LEU A . n A 1 43 LYS 43 40 40 LYS LYS A . n A 1 44 TRP 44 41 41 TRP TRP A . n A 1 45 LYS 45 42 42 LYS LYS A . n A 1 46 GLY 46 43 43 GLY GLY A . n A 1 47 PHE 47 44 44 PHE PHE A . n A 1 48 SER 48 45 45 SER SER A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 GLU 50 47 47 GLU GLU A . n A 1 51 HIS 51 48 48 HIS HIS A . n A 1 52 ASN 52 49 49 ASN ASN A . n A 1 53 THR 53 50 50 THR THR A . n A 1 54 TRP 54 51 51 TRP TRP A . n A 1 55 GLU 55 52 52 GLU GLU A . n A 1 56 PRO 56 53 53 PRO PRO A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 ASN 59 56 56 ASN ASN A . n A 1 60 LEU 60 57 57 LEU LEU A . n A 1 61 ASP 61 58 58 ASP ASP A . n A 1 62 CYS 62 59 59 CYS CYS A . n A 1 63 PRO 63 60 60 PRO PRO A . n A 1 64 GLU 64 61 61 GLU GLU A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 ILE 66 63 63 ILE ILE A . n A 1 67 SER 67 64 64 SER SER A . n A 1 68 GLU 68 65 65 GLU GLU A . n A 1 69 PHE 69 66 66 PHE PHE A . n A 1 70 MET 70 67 67 MET MET A . n A 1 71 LYS 71 68 68 LYS LYS A . n A 1 72 LYS 72 69 69 LYS LYS A . n A 1 73 TYR 73 70 70 TYR TYR A . n A 1 74 LYS 74 71 71 LYS LYS A . n A 1 75 LYS 75 72 72 LYS LYS A . n A 1 76 MET 76 73 73 MET MET A . n A 1 77 LYS 77 74 74 LYS LYS A . n A 1 78 GLU 78 75 75 GLU GLU A . n A 1 79 GLY 79 76 76 GLY GLY A . n A 1 80 GLU 80 77 77 GLU GLU A . n A 1 81 ASN 81 78 78 ASN ASN A . n A 1 82 ASN 82 79 79 ASN ASN A . n A 1 83 LYS 83 80 80 LYS LYS A . n B 2 1 ALA 1 1 1 ALA ALA B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 THR 3 3 3 THR THR B . n B 2 4 LYS 4 4 4 LYS LYS B . n B 2 5 GLN 5 5 5 GLN GLN B . n B 2 6 THR 6 6 6 THR THR B . n B 2 7 ALA 7 7 7 ALA ALA B . n B 2 8 ARG 8 8 8 ARG ARG B . n B 2 9 M3L 9 9 9 M3L M3L B . n B 2 10 SER 10 10 10 SER SER B . n B 2 11 THR 11 11 11 THR THR B . n B 2 12 GLY 12 12 12 GLY GLY B . n B 2 13 GLY 13 13 13 GLY GLY B . n B 2 14 LYS 14 14 14 LYS LYS B . n B 2 15 ALA 15 15 15 ALA ALA B . n B 2 16 PRO 16 16 16 PRO PRO B . n B 2 17 ARG 17 17 17 ARG ARG B . n B 2 18 TYR 18 18 18 TYR TYR B . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A SEP 14 A SEP 11 ? SER PHOSPHOSERINE 2 A SEP 15 A SEP 12 ? SER PHOSPHOSERINE 3 A SEP 16 A SEP 13 ? SER PHOSPHOSERINE 4 A SEP 17 A SEP 14 ? SER PHOSPHOSERINE 5 B M3L 9 B M3L 9 ? LYS N-TRIMETHYLLYSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2016-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium phosphate-1' 20 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium chloride-2' 10 ? mM '[U-99% 13C; U-99% 15N]' 1 DTT-3 5 ? mM '[U-99% 13C; U-99% 15N]' 1 'potassium phosphate-4' 20 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium chloride-5' 10 ? mM '[U-99% 13C; U-99% 15N]' 2 DTT-6 5 ? mM '[U-99% 13C; U-99% 15N]' 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 18 ? ? -145.16 -53.76 2 1 LEU A 57 ? ? -55.85 104.73 3 1 ASP A 58 ? ? -107.55 46.96 4 1 CYS A 59 ? ? -161.51 81.22 5 1 THR B 3 ? ? -132.30 -52.26 6 1 ALA B 15 ? ? -112.57 77.22 7 2 LEU A 57 ? ? -55.42 100.31 8 2 ASP A 58 ? ? -106.47 52.52 9 2 CYS A 59 ? ? -159.12 80.43 10 3 SEP A 12 ? ? -109.63 77.64 11 3 SEP A 13 ? ? 54.07 -175.92 12 3 GLU A 17 ? ? 55.22 97.18 13 3 LEU A 57 ? ? -54.56 100.90 14 3 ASP A 58 ? ? -105.99 53.86 15 3 CYS A 59 ? ? -159.44 80.98 16 4 GLU A 18 ? ? -161.98 108.00 17 4 LYS A 42 ? ? -51.14 106.23 18 4 LEU A 57 ? ? -53.52 101.59 19 4 ASP A 58 ? ? -104.34 55.66 20 4 CYS A 59 ? ? -162.50 81.02 21 5 LEU A 57 ? ? -53.45 101.84 22 5 ASP A 58 ? ? -101.30 53.24 23 5 CYS A 59 ? ? -162.23 79.55 24 6 LEU A 57 ? ? -54.23 101.07 25 6 ASP A 58 ? ? -105.02 52.78 26 6 CYS A 59 ? ? -159.27 79.52 27 6 ARG B 2 ? ? -119.90 53.11 28 6 LYS B 4 ? ? -163.17 108.86 29 7 HIS A 0 ? ? 39.20 42.49 30 7 LEU A 57 ? ? -54.44 101.15 31 7 ASP A 58 ? ? -101.75 54.82 32 7 CYS A 59 ? ? -160.79 80.54 33 8 LYS A 3 ? ? 57.14 96.13 34 8 GLU A 18 ? ? -130.02 -53.38 35 8 LEU A 57 ? ? -55.49 103.21 36 8 ASP A 58 ? ? -108.66 42.08 37 8 CYS A 59 ? ? -161.48 82.65 38 8 GLU A 77 ? ? 58.30 98.51 39 9 SEP A 11 ? ? -163.09 88.98 40 9 ASP A 16 ? ? -59.24 107.94 41 9 LEU A 57 ? ? -51.97 102.67 42 9 ASP A 58 ? ? -102.32 45.74 43 9 CYS A 59 ? ? -152.87 75.55 44 10 SER A -1 ? ? -164.95 109.48 45 10 LEU A 57 ? ? -55.70 100.06 46 10 ASP A 58 ? ? -103.31 55.20 47 10 CYS A 59 ? ? -160.33 82.27 48 10 ALA B 15 ? ? -112.62 77.28 49 11 SEP A 13 ? ? -162.87 -62.00 50 11 LEU A 57 ? ? -49.15 103.91 51 11 ASP A 58 ? ? -104.29 48.41 52 11 CYS A 59 ? ? -154.42 82.70 53 12 GLU A 18 ? ? -108.06 55.22 54 12 LEU A 57 ? ? -55.88 100.72 55 12 ASP A 58 ? ? -101.40 45.86 56 12 CYS A 59 ? ? -156.15 75.03 57 13 LEU A 57 ? ? -58.16 105.67 58 13 ASP A 58 ? ? -109.76 42.48 59 13 CYS A 59 ? ? -159.10 84.45 60 13 ALA B 15 ? ? 53.88 77.20 61 14 SEP A 12 ? ? -129.23 -62.13 62 14 GLU A 18 ? ? -94.00 39.71 63 14 LEU A 57 ? ? -55.15 100.72 64 14 ASP A 58 ? ? -105.19 44.22 65 14 CYS A 59 ? ? -158.29 82.27 66 15 LYS A 3 ? ? 56.11 95.79 67 15 SEP A 12 ? ? -106.23 -61.89 68 15 SEP A 13 ? ? 60.66 88.77 69 15 LEU A 57 ? ? -54.75 100.56 70 15 ASP A 58 ? ? -103.15 52.87 71 15 CYS A 59 ? ? -158.99 80.06 72 16 LYS A 6 ? ? -165.29 107.30 73 16 LEU A 57 ? ? -55.30 100.43 74 16 ASP A 58 ? ? -104.56 51.23 75 16 CYS A 59 ? ? -157.22 78.19 76 16 GLU A 77 ? ? 56.47 97.81 77 17 ALA A 9 ? ? -161.83 110.22 78 17 GLU A 17 ? ? -56.69 107.60 79 17 LEU A 57 ? ? -57.35 102.17 80 17 ASP A 58 ? ? -108.51 49.95 81 17 CYS A 59 ? ? -161.57 81.33 82 17 LYS B 4 ? ? -164.83 119.54 83 17 ALA B 15 ? ? 61.74 160.89 84 18 SEP A 11 ? ? -163.12 88.37 85 18 SEP A 12 ? ? -98.89 -62.19 86 18 LEU A 57 ? ? -56.09 100.16 87 18 ASP A 58 ? ? -102.47 53.98 88 18 CYS A 59 ? ? -165.85 75.56 89 19 HIS A 0 ? ? 55.00 96.32 90 19 SEP A 12 ? ? -113.56 79.46 91 19 SEP A 14 ? ? 63.21 159.41 92 19 LEU A 57 ? ? -54.16 100.49 93 19 ASP A 58 ? ? -105.11 56.36 94 19 CYS A 59 ? ? -162.79 81.49 95 19 ASN A 79 ? ? 60.35 102.41 96 20 GLU A 18 ? ? -164.83 104.94 97 20 LEU A 57 ? ? -58.16 103.05 98 20 ASP A 58 ? ? -106.26 48.61 99 20 CYS A 59 ? ? -165.72 81.98 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ARG B 8 ? ? M3L B 9 ? ? -136.13 2 2 ARG B 8 ? ? M3L B 9 ? ? -136.19 3 3 ARG B 8 ? ? M3L B 9 ? ? -136.12 4 4 ARG B 8 ? ? M3L B 9 ? ? -136.17 5 5 ARG B 8 ? ? M3L B 9 ? ? -136.11 6 6 ARG B 8 ? ? M3L B 9 ? ? -136.20 7 7 ARG B 8 ? ? M3L B 9 ? ? -136.15 8 8 ARG B 8 ? ? M3L B 9 ? ? -136.14 9 9 ARG B 8 ? ? M3L B 9 ? ? -136.13 10 10 ARG B 8 ? ? M3L B 9 ? ? -136.14 11 11 ARG B 8 ? ? M3L B 9 ? ? -136.15 12 12 ARG B 8 ? ? M3L B 9 ? ? -136.19 13 13 ARG B 8 ? ? M3L B 9 ? ? -136.09 14 14 ARG B 8 ? ? M3L B 9 ? ? -136.12 15 15 ARG B 8 ? ? M3L B 9 ? ? -136.12 16 16 ARG B 8 ? ? M3L B 9 ? ? -136.11 17 17 ARG B 8 ? ? M3L B 9 ? ? -136.16 18 18 ARG B 8 ? ? M3L B 9 ? ? -136.13 19 19 ARG B 8 ? ? M3L B 9 ? ? -136.16 20 20 ARG B 8 ? ? M3L B 9 ? ? -136.15 #