data_2TMY # _entry.id 2TMY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2TMY pdb_00002tmy 10.2210/pdb2tmy/pdb WWPDB D_1000178688 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2TMY _pdbx_database_status.recvd_initial_deposition_date 1997-05-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Usher, K.C.' 1 'De La Cruz, A.' 2 'Dahlquist, F.W.' 3 'Remington, S.J.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Crystal structures of CheY from Thermotoga maritima do not support conventional explanations for the structural basis of enhanced thermostability. ; 'Protein Sci.' 7 403 412 1998 PRCIEI US 0961-8368 0795 ? 9521117 ? 1 'Magnesium Binding to the Bacterial Chemotaxis Protein Chey Results in Large Conformational Changes Involving its Functional Surface' J.Mol.Biol. 238 489 ? 1994 JMOBAK UK 0022-2836 0070 ? ? ? 2 ;Erratum. Magnesium Binding to the Bacterial Chemotaxis Protein Chey Results in Large Conformational Changes Involving its Functional Surface ; J.Mol.Biol. 242 103 ? 1994 JMOBAK UK 0022-2836 0070 ? ? ? 3 'Crystal Structure of Escherichia Coli Chey Refined at 1.7-A Resolution' J.Biol.Chem. 266 15511 ? 1991 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Usher, K.C.' 1 ? primary 'de la Cruz, A.F.' 2 ? primary 'Dahlquist, F.W.' 3 ? primary 'Swanson, R.V.' 4 ? primary 'Simon, M.I.' 5 ? primary 'Remington, S.J.' 6 ? 1 'Bellsolell, L.' 7 ? 1 'Prieto, J.' 8 ? 1 'Serrano, L.' 9 ? 1 'Coll, M.' 10 ? 2 'Bellsolell, L.' 11 ? 2 'Prieto, J.' 12 ? 2 'Serrano, L.' 13 ? 2 'Coll, M.' 14 ? 3 'Volz, K.' 15 ? 3 'Matsumura, P.' 16 ? # _cell.entry_id 2TMY _cell.length_a 98.657 _cell.length_b 98.657 _cell.length_c 32.254 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2TMY _symmetry.space_group_name_H-M 'P 4 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 90 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CHEY PROTEIN' 13234.754 1 ? ? ? ? 2 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TMY # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIV CSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVSK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIV CSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVSK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LYS n 1 4 ARG n 1 5 VAL n 1 6 LEU n 1 7 ILE n 1 8 VAL n 1 9 ASP n 1 10 ASP n 1 11 ALA n 1 12 ALA n 1 13 PHE n 1 14 MET n 1 15 ARG n 1 16 MET n 1 17 MET n 1 18 LEU n 1 19 LYS n 1 20 ASP n 1 21 ILE n 1 22 ILE n 1 23 THR n 1 24 LYS n 1 25 ALA n 1 26 GLY n 1 27 TYR n 1 28 GLU n 1 29 VAL n 1 30 ALA n 1 31 GLY n 1 32 GLU n 1 33 ALA n 1 34 THR n 1 35 ASN n 1 36 GLY n 1 37 ARG n 1 38 GLU n 1 39 ALA n 1 40 VAL n 1 41 GLU n 1 42 LYS n 1 43 TYR n 1 44 LYS n 1 45 GLU n 1 46 LEU n 1 47 LYS n 1 48 PRO n 1 49 ASP n 1 50 ILE n 1 51 VAL n 1 52 THR n 1 53 MET n 1 54 ASP n 1 55 ILE n 1 56 THR n 1 57 MET n 1 58 PRO n 1 59 GLU n 1 60 MET n 1 61 ASN n 1 62 GLY n 1 63 ILE n 1 64 ASP n 1 65 ALA n 1 66 ILE n 1 67 LYS n 1 68 GLU n 1 69 ILE n 1 70 MET n 1 71 LYS n 1 72 ILE n 1 73 ASP n 1 74 PRO n 1 75 ASN n 1 76 ALA n 1 77 LYS n 1 78 ILE n 1 79 ILE n 1 80 VAL n 1 81 CYS n 1 82 SER n 1 83 ALA n 1 84 MET n 1 85 GLY n 1 86 GLN n 1 87 GLN n 1 88 ALA n 1 89 MET n 1 90 VAL n 1 91 ILE n 1 92 GLU n 1 93 ALA n 1 94 ILE n 1 95 LYS n 1 96 ALA n 1 97 GLY n 1 98 ALA n 1 99 LYS n 1 100 ASP n 1 101 PHE n 1 102 ILE n 1 103 VAL n 1 104 LYS n 1 105 PRO n 1 106 PHE n 1 107 GLN n 1 108 PRO n 1 109 SER n 1 110 ARG n 1 111 VAL n 1 112 VAL n 1 113 GLU n 1 114 ALA n 1 115 LEU n 1 116 ASN n 1 117 LYS n 1 118 VAL n 1 119 SER n 1 120 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermotoga _entity_src_gen.pdbx_gene_src_gene CHEY _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2336 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location CYTOPLASM _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene CHEY _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain K0641/RECA _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location CYTOPLASM _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PQE12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CHEY_THEMA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q56312 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MGKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIV CSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVSK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2TMY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q56312 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 120 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2TMY _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.0 _exptl_crystal.density_percent_sol 63. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.2M AMMONIUM SULFATE, 0.1M ACETATE BUFFER (PH 4.6), 30% PEG 4000, 15MM MGCL2' # _diffrn.id 1 _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type 'XUONG-HAMLIN MULTIWIRE' _diffrn_detector.pdbx_collection_date 1995-12-15 _diffrn_detector.details COLLIMATOR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 2TMY _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.3 _reflns.number_obs 6660 _reflns.number_all ? _reflns.percent_possible_obs 89. _reflns.pdbx_Rmerge_I_obs 0.0680000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.8 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.9 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.6 _reflns_shell.percent_possible_all 76. _reflns_shell.Rmerge_I_obs 0.1840000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.5 _reflns_shell.pdbx_redundancy 1.7 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2TMY _refine.ls_number_reflns_obs 6660 _refine.ls_number_reflns_all 6660 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs 89. _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1810000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'BABINET SCALING' _refine.solvent_model_param_ksol 1.21 _refine.solvent_model_param_bsol 863 _refine.pdbx_ls_cross_valid_method ? _refine.details ;DISORDERED SIDE-CHAINS WERE MODELED STEREOCHEMICALLY AND HAVE THEIR OCCUPANCY SET ARBITRARILY TO 0.0. ; _refine.pdbx_starting_model 'PDB ENTRY 1TMY' _refine.pdbx_method_to_determine_struct 'SIRAS / MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model 'TNT BCORREL V1.0' _refine.pdbx_stereochemistry_target_values 'TNT PROTGEO' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 900 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 919 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.013 ? 1.5 913 'X-RAY DIFFRACTION' ? t_angle_deg 2.19 ? 3.0 1219 'X-RAY DIFFRACTION' ? t_dihedral_angle_d 19.8 ? 0.0 575 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct 0 ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes 0.015 ? 2 24 'X-RAY DIFFRACTION' ? t_gen_planes 0.018 ? 5 127 'X-RAY DIFFRACTION' ? t_it 9.88 ? 0.5 913 'X-RAY DIFFRACTION' ? t_nbd 0.020 ? 20 9 'X-RAY DIFFRACTION' ? # _pdbx_refine.entry_id 2TMY _pdbx_refine.R_factor_all_no_cutoff ? _pdbx_refine.R_factor_obs_no_cutoff 0.1810000 _pdbx_refine.free_R_factor_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 2TMY _struct.title 'CHEY FROM THERMOTOGA MARITIMA (APO-II)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2TMY _struct_keywords.pdbx_keywords CHEMOTAXIS _struct_keywords.text 'CHEMOTAXIS, PHOSPHORYL TRANSFER, SIGNAL TRANSDUCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 12 ? LYS A 24 ? ALA A 12 LYS A 24 1 ? 13 HELX_P HELX_P2 2 GLY A 36 ? LEU A 46 ? GLY A 36 LEU A 46 1 ? 11 HELX_P HELX_P3 3 PRO A 58 ? MET A 60 ? PRO A 58 MET A 60 5 ? 3 HELX_P HELX_P4 4 GLY A 62 ? ILE A 72 ? GLY A 62 ILE A 72 1 ? 11 HELX_P HELX_P5 5 GLN A 87 ? LYS A 95 ? GLN A 87 LYS A 95 1 ? 9 HELX_P HELX_P6 6 PRO A 108 ? LYS A 117 ? PRO A 108 LYS A 117 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 104 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 104 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 105 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 105 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.50 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 100 ? LYS A 104 ? ASP A 100 LYS A 104 A 2 ILE A 78 ? ALA A 83 ? ILE A 78 ALA A 83 A 3 ILE A 50 ? ASP A 54 ? ILE A 50 ASP A 54 A 4 ARG A 4 ? VAL A 8 ? ARG A 4 VAL A 8 A 5 GLU A 28 ? ALA A 33 ? GLU A 28 ALA A 33 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASP A 100 ? O ASP A 100 N VAL A 80 ? N VAL A 80 A 2 3 O ILE A 79 ? O ILE A 79 N VAL A 51 ? N VAL A 51 A 3 4 O ILE A 50 ? O ILE A 50 N LEU A 6 ? N LEU A 6 A 4 5 O VAL A 5 ? O VAL A 5 N GLU A 28 ? N GLU A 28 # _struct_site.id ACT _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'ACTIVE SITE AND METAL BINDING SITE.' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 ACT 4 ASP A 54 ? ASP A 54 . ? 1_555 ? 2 ACT 4 LYS A 104 ? LYS A 104 . ? 1_555 ? 3 ACT 4 ASP A 9 ? ASP A 9 . ? 1_555 ? 4 ACT 4 ASP A 10 ? ASP A 10 . ? 1_555 ? # _database_PDB_matrix.entry_id 2TMY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2TMY _atom_sites.fract_transf_matrix[1][1] 0.010136 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010136 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031004 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 LYS 120 120 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 200 200 HOH HOH A . B 2 HOH 2 201 201 HOH HOH A . B 2 HOH 3 202 202 HOH HOH A . B 2 HOH 4 203 203 HOH HOH A . B 2 HOH 5 204 204 HOH HOH A . B 2 HOH 6 205 205 HOH HOH A . B 2 HOH 7 206 206 HOH HOH A . B 2 HOH 8 207 207 HOH HOH A . B 2 HOH 9 208 208 HOH HOH A . B 2 HOH 10 209 209 HOH HOH A . B 2 HOH 11 210 210 HOH HOH A . B 2 HOH 12 211 211 HOH HOH A . B 2 HOH 13 212 212 HOH HOH A . B 2 HOH 14 213 213 HOH HOH A . B 2 HOH 15 214 214 HOH HOH A . B 2 HOH 16 215 215 HOH HOH A . B 2 HOH 17 216 216 HOH HOH A . B 2 HOH 18 217 217 HOH HOH A . B 2 HOH 19 218 218 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-12-03 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal RSS 'model building' . ? 1 TNT refinement 5E ? 2 SDMS 'data reduction' '(DCREDUCE)' ? 3 SDMS 'data scaling' '(SCALE)' ? 4 RSS phasing . ? 5 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 28 ? ? OE2 A GLU 28 ? ? 1.327 1.252 0.075 0.011 N 2 1 CD A GLU 45 ? ? OE1 A GLU 45 ? ? 1.320 1.252 0.068 0.011 N 3 1 CD A GLU 68 ? ? OE1 A GLU 68 ? ? 1.320 1.252 0.068 0.011 N 4 1 CD A GLU 113 ? ? OE2 A GLU 113 ? ? 1.323 1.252 0.071 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 112.31 118.30 -5.99 0.90 N 2 1 CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 111.81 118.30 -6.49 0.90 N 3 1 CB A ASP 54 ? ? CG A ASP 54 ? ? OD2 A ASP 54 ? ? 112.40 118.30 -5.90 0.90 N 4 1 CB A ASP 64 ? ? CG A ASP 64 ? ? OD1 A ASP 64 ? ? 112.73 118.30 -5.57 0.90 N 5 1 CB A ASP 100 ? ? CG A ASP 100 ? ? OD1 A ASP 100 ? ? 124.63 118.30 6.33 0.90 N 6 1 CB A ASP 100 ? ? CG A ASP 100 ? ? OD2 A ASP 100 ? ? 112.24 118.30 -6.06 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 9 ? ? -170.34 137.18 2 1 PRO A 108 ? ? -27.53 -51.50 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLU 41 ? CD ? A GLU 41 CD 2 1 Y 0 A GLU 41 ? OE1 ? A GLU 41 OE1 3 1 Y 0 A GLU 41 ? OE2 ? A GLU 41 OE2 4 1 Y 0 A LYS 47 ? CG ? A LYS 47 CG 5 1 Y 0 A LYS 47 ? CD ? A LYS 47 CD 6 1 Y 0 A LYS 47 ? CE ? A LYS 47 CE 7 1 Y 0 A LYS 47 ? NZ ? A LYS 47 NZ 8 1 Y 0 A LYS 71 ? CD ? A LYS 71 CD 9 1 Y 0 A LYS 71 ? CE ? A LYS 71 CE 10 1 Y 0 A LYS 71 ? NZ ? A LYS 71 NZ 11 1 Y 0 A GLN 107 ? CG ? A GLN 107 CG 12 1 Y 0 A GLN 107 ? CD ? A GLN 107 CD 13 1 Y 0 A GLN 107 ? OE1 ? A GLN 107 OE1 14 1 Y 0 A GLN 107 ? NE2 ? A GLN 107 NE2 15 1 Y 0 A ARG 110 ? NE ? A ARG 110 NE 16 1 Y 0 A ARG 110 ? CZ ? A ARG 110 CZ 17 1 Y 0 A ARG 110 ? NH1 ? A ARG 110 NH1 18 1 Y 0 A ARG 110 ? NH2 ? A ARG 110 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 120 ? A LYS 120 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1TMY _pdbx_initial_refinement_model.details 'PDB ENTRY 1TMY' #