data_2V06 # _entry.id 2V06 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.312 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2V06 PDBE EBI-32485 WWPDB D_1290032485 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2JFR unspecified 'CRYSTAL STRUCTURE OF THE PPM SER-THR PHOSPHATASE MSPP FROM MYCOBACTERIUM SMEGMATIS IN COMPLEX WITH PHOSPHATE AT 0.83 A RESOLUTION' PDB 2JFS unspecified 'CRYSTAL STRUCTURE OF THE PPM SER-THR PHOSPHATASE MSPP FROM MYCOBACTERIUM SMEGMATIS IN COMPLEX WITH CACODYLATE' PDB 2JFT unspecified 'CRYSTAL STRUCTURE OF THE PPM SER-THR PHOSPHATASE MSPP FROM MYCOBACTERIUM SMEGMATIS IN COMPLEX WITH SULFATE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2V06 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2007-05-08 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wehenkel, A.' 1 'Bellinzoni, M.' 2 'Schaeffer, F.' 3 'Villarino, A.' 4 'Alzari, P.M.' 5 # _citation.id primary _citation.title 'Structural and Binding Studies of the Three-Metal Center in Two Mycobacterial Ppm Ser/Thr Protein Phosphatases.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 374 _citation.page_first 890 _citation.page_last ? _citation.year 2007 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17961594 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2007.09.076 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wehenkel, A.' 1 ? primary 'Bellinzoni, M.' 2 ? primary 'Schaeffer, F.' 3 ? primary 'Villarino, A.' 4 ? primary 'Alzari, P.M.' 5 ? # _cell.entry_id 2V06 _cell.length_a 74.718 _cell.length_b 83.596 _cell.length_c 33.638 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2V06 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SER-THR PHOSPHATASE MSPP' 24278.018 1 3.1.3.- ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 387 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMASVLSAATATDQGPVRENNQDACLADGILYAVADGFGARGHHASATALKTLSAGFAAAPDRDGLLEAVQQANLRVFEL LGDEPTVSGTTLTAVAVFEPGQGGPLVVNIGDSPLYRIRDGHMEQLTDDHSVAGELVRMGEITRHEARWHPQRHLLTRAL GIGPHIGPDVFGIDCGPGDRLLISSDGLFAAADEALIVDAATSPDPQVAVRRLVEVANDAGGSDNTTVVVIDLG ; _entity_poly.pdbx_seq_one_letter_code_can ;GMASVLSAATATDQGPVRENNQDACLADGILYAVADGFGARGHHASATALKTLSAGFAAAPDRDGLLEAVQQANLRVFEL LGDEPTVSGTTLTAVAVFEPGQGGPLVVNIGDSPLYRIRDGHMEQLTDDHSVAGELVRMGEITRHEARWHPQRHLLTRAL GIGPHIGPDVFGIDCGPGDRLLISSDGLFAAADEALIVDAATSPDPQVAVRRLVEVANDAGGSDNTTVVVIDLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 ALA n 1 4 SER n 1 5 VAL n 1 6 LEU n 1 7 SER n 1 8 ALA n 1 9 ALA n 1 10 THR n 1 11 ALA n 1 12 THR n 1 13 ASP n 1 14 GLN n 1 15 GLY n 1 16 PRO n 1 17 VAL n 1 18 ARG n 1 19 GLU n 1 20 ASN n 1 21 ASN n 1 22 GLN n 1 23 ASP n 1 24 ALA n 1 25 CYS n 1 26 LEU n 1 27 ALA n 1 28 ASP n 1 29 GLY n 1 30 ILE n 1 31 LEU n 1 32 TYR n 1 33 ALA n 1 34 VAL n 1 35 ALA n 1 36 ASP n 1 37 GLY n 1 38 PHE n 1 39 GLY n 1 40 ALA n 1 41 ARG n 1 42 GLY n 1 43 HIS n 1 44 HIS n 1 45 ALA n 1 46 SER n 1 47 ALA n 1 48 THR n 1 49 ALA n 1 50 LEU n 1 51 LYS n 1 52 THR n 1 53 LEU n 1 54 SER n 1 55 ALA n 1 56 GLY n 1 57 PHE n 1 58 ALA n 1 59 ALA n 1 60 ALA n 1 61 PRO n 1 62 ASP n 1 63 ARG n 1 64 ASP n 1 65 GLY n 1 66 LEU n 1 67 LEU n 1 68 GLU n 1 69 ALA n 1 70 VAL n 1 71 GLN n 1 72 GLN n 1 73 ALA n 1 74 ASN n 1 75 LEU n 1 76 ARG n 1 77 VAL n 1 78 PHE n 1 79 GLU n 1 80 LEU n 1 81 LEU n 1 82 GLY n 1 83 ASP n 1 84 GLU n 1 85 PRO n 1 86 THR n 1 87 VAL n 1 88 SER n 1 89 GLY n 1 90 THR n 1 91 THR n 1 92 LEU n 1 93 THR n 1 94 ALA n 1 95 VAL n 1 96 ALA n 1 97 VAL n 1 98 PHE n 1 99 GLU n 1 100 PRO n 1 101 GLY n 1 102 GLN n 1 103 GLY n 1 104 GLY n 1 105 PRO n 1 106 LEU n 1 107 VAL n 1 108 VAL n 1 109 ASN n 1 110 ILE n 1 111 GLY n 1 112 ASP n 1 113 SER n 1 114 PRO n 1 115 LEU n 1 116 TYR n 1 117 ARG n 1 118 ILE n 1 119 ARG n 1 120 ASP n 1 121 GLY n 1 122 HIS n 1 123 MET n 1 124 GLU n 1 125 GLN n 1 126 LEU n 1 127 THR n 1 128 ASP n 1 129 ASP n 1 130 HIS n 1 131 SER n 1 132 VAL n 1 133 ALA n 1 134 GLY n 1 135 GLU n 1 136 LEU n 1 137 VAL n 1 138 ARG n 1 139 MET n 1 140 GLY n 1 141 GLU n 1 142 ILE n 1 143 THR n 1 144 ARG n 1 145 HIS n 1 146 GLU n 1 147 ALA n 1 148 ARG n 1 149 TRP n 1 150 HIS n 1 151 PRO n 1 152 GLN n 1 153 ARG n 1 154 HIS n 1 155 LEU n 1 156 LEU n 1 157 THR n 1 158 ARG n 1 159 ALA n 1 160 LEU n 1 161 GLY n 1 162 ILE n 1 163 GLY n 1 164 PRO n 1 165 HIS n 1 166 ILE n 1 167 GLY n 1 168 PRO n 1 169 ASP n 1 170 VAL n 1 171 PHE n 1 172 GLY n 1 173 ILE n 1 174 ASP n 1 175 CYS n 1 176 GLY n 1 177 PRO n 1 178 GLY n 1 179 ASP n 1 180 ARG n 1 181 LEU n 1 182 LEU n 1 183 ILE n 1 184 SER n 1 185 SER n 1 186 ASP n 1 187 GLY n 1 188 LEU n 1 189 PHE n 1 190 ALA n 1 191 ALA n 1 192 ALA n 1 193 ASP n 1 194 GLU n 1 195 ALA n 1 196 LEU n 1 197 ILE n 1 198 VAL n 1 199 ASP n 1 200 ALA n 1 201 ALA n 1 202 THR n 1 203 SER n 1 204 PRO n 1 205 ASP n 1 206 PRO n 1 207 GLN n 1 208 VAL n 1 209 ALA n 1 210 VAL n 1 211 ARG n 1 212 ARG n 1 213 LEU n 1 214 VAL n 1 215 GLU n 1 216 VAL n 1 217 ALA n 1 218 ASN n 1 219 ASP n 1 220 ALA n 1 221 GLY n 1 222 GLY n 1 223 SER n 1 224 ASP n 1 225 ASN n 1 226 THR n 1 227 THR n 1 228 VAL n 1 229 VAL n 1 230 VAL n 1 231 ILE n 1 232 ASP n 1 233 LEU n 1 234 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MC2155 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'MYCOBACTERIUM SMEGMATIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1772 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET-28A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2V06 1 ? ? 2V06 ? 2 UNP A0QTQ6_MYCS2 1 ? ? A0QTQ6 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2V06 A 1 ? 1 ? 2V06 0 ? 0 ? 0 0 2 2 2V06 A 2 ? 234 ? A0QTQ6 1 ? 233 ? 1 233 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2V06 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.1 _exptl_crystal.density_percent_sol 40.9 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 5.5' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2006-06-03 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(311)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE BW7A' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, HAMBURG' _diffrn_source.pdbx_synchrotron_beamline BW7A _diffrn_source.pdbx_wavelength 0.9000 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2V06 _reflns.observed_criterion_sigma_I . _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 15.00 _reflns.d_resolution_high 1.05 _reflns.number_obs 97914 _reflns.number_all ? _reflns.percent_possible_obs 98.8 _reflns.pdbx_Rmerge_I_obs 0.03 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.30 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.7 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.05 _reflns_shell.d_res_low 1.10 _reflns_shell.percent_possible_all 99.2 _reflns_shell.Rmerge_I_obs 0.41 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.70 _reflns_shell.pdbx_redundancy 2.5 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2V06 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all 97463 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.00 _refine.ls_d_res_high 1.05 _refine.ls_percent_reflns_obs 98.8 _refine.ls_R_factor_obs 0.1314 _refine.ls_R_factor_all 0.1328 _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free 0.1875 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 4873 _refine.ls_number_parameters 20542 _refine.ls_number_restraints 26496 _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details 'HYDROGENS HAVE BEEN ADDED IN RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH AND HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 2V06 _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 81 _refine_analyze.occupancy_sum_hydrogen 1634.00 _refine_analyze.occupancy_sum_non_hydrogen 2062.17 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1706 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 387 _refine_hist.number_atoms_total 2097 _refine_hist.d_res_high 1.05 _refine_hist.d_res_low 6.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.014 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.035 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.0286 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.088 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.080 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.046 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.005 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.060 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.100 ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 2V06 _pdbx_refine.R_factor_all_no_cutoff 0.1328 _pdbx_refine.R_factor_obs_no_cutoff 0.1314 _pdbx_refine.free_R_factor_no_cutoff 0.1875 _pdbx_refine.free_R_error_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 5.0 _pdbx_refine.free_R_val_test_set_ct_no_cutoff 4873 _pdbx_refine.R_factor_all_4sig_cutoff 0.1262 _pdbx_refine.R_factor_obs_4sig_cutoff 0.1248 _pdbx_refine.free_R_factor_4sig_cutoff 0.1799 _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff 5.0 _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff 4124 _pdbx_refine.number_reflns_obs_4sig_cutoff 82702 # _struct.entry_id 2V06 _struct.title 'Crystal structure of the PPM Ser-Thr phosphatase MsPP from Mycobacterium smegmatis at pH 5.5' _struct.pdbx_descriptor 'SER-THR PHOSPHATASE MSPP (E.C.3.1.3.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2V06 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'PP2C-LIKE PHOSPHATASE, METAL BINDING, MYCOBACTERIUM, REGULATORY PROTEIN, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 2 ? F N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 41 ? ALA A 60 ? ARG A 40 ALA A 59 1 ? 20 HELX_P HELX_P2 2 ASP A 62 ? GLY A 82 ? ASP A 61 GLY A 81 1 ? 21 HELX_P HELX_P3 3 GLU A 99 ? GLY A 103 ? GLU A 98 GLY A 102 5 ? 5 HELX_P HELX_P4 4 SER A 131 ? MET A 139 ? SER A 130 MET A 138 1 ? 9 HELX_P HELX_P5 5 THR A 143 ? ARG A 148 ? THR A 142 ARG A 147 1 ? 6 HELX_P HELX_P6 6 ASP A 186 ? ALA A 190 ? ASP A 185 ALA A 189 5 ? 5 HELX_P HELX_P7 7 ASP A 193 ? THR A 202 ? ASP A 192 THR A 201 1 ? 10 HELX_P HELX_P8 8 ASP A 205 ? ALA A 220 ? ASP A 204 ALA A 219 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1234 A HOH 2381 1_555 ? ? ? ? ? ? ? 2.106 ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 186 OD1 A ? A MG 1234 A ASP 185 1_555 ? ? ? ? ? ? ? 1.983 ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 186 OD1 B ? A MG 1234 A ASP 185 1_555 ? ? ? ? ? ? ? 2.100 ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 36 OD2 ? ? A MG 1234 A ASP 35 1_555 ? ? ? ? ? ? ? 2.065 ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 224 OD2 ? ? A MG 1234 A ASP 223 1_555 ? ? ? ? ? ? ? 2.100 ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1234 A HOH 2322 1_555 ? ? ? ? ? ? ? 2.097 ? metalc7 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1234 A HOH 2379 1_555 ? ? ? ? ? ? ? 2.207 ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 A GLY 37 O ? ? A MG 1235 A GLY 36 1_555 ? ? ? ? ? ? ? 2.100 ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1235 A HOH 2063 1_555 ? ? ? ? ? ? ? 2.063 ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1235 A HOH 2070 1_555 ? ? ? ? ? ? ? 2.079 ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1235 A HOH 2098 1_555 ? ? ? ? ? ? ? 2.069 ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1235 A HOH 2379 1_555 ? ? ? ? ? ? ? 2.154 ? metalc13 metalc ? ? C MG . MG ? ? ? 1_555 A ASP 36 OD1 ? ? A MG 1235 A ASP 35 1_555 ? ? ? ? ? ? ? 2.011 ? metalc14 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1237 A HOH 2343 3_656 ? ? ? ? ? ? ? 2.107 ? metalc15 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1237 A HOH 2357 3_656 ? ? ? ? ? ? ? 2.046 ? metalc16 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1237 A HOH 2336 3_656 ? ? ? ? ? ? ? 2.036 ? metalc17 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1237 A HOH 2342 3_656 ? ? ? ? ? ? ? 2.316 ? metalc18 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1237 A HOH 2163 3_656 ? ? ? ? ? ? ? 2.076 ? metalc19 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1237 A HOH 2164 3_656 ? ? ? ? ? ? ? 2.003 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 5 ? AC ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 5 ? ASP A 13 ? VAL A 4 ASP A 12 AA 2 THR A 226 ? LEU A 233 ? THR A 225 LEU A 232 AA 3 ARG A 180 ? SER A 184 ? ARG A 179 SER A 183 AA 4 LEU A 115 ? ARG A 119 ? LEU A 114 ARG A 118 AA 5 HIS A 122 ? GLN A 125 ? HIS A 121 GLN A 124 AB 1 ASP A 23 ? ASP A 28 ? ASP A 22 ASP A 27 AB 2 LEU A 31 ? PHE A 38 ? LEU A 30 PHE A 37 AB 3 LEU A 92 ? ALA A 96 ? LEU A 91 ALA A 95 AB 4 LEU A 106 ? ILE A 110 ? LEU A 105 ILE A 109 AB 5 ASP A 169 ? GLY A 172 ? ASP A 168 GLY A 171 AC 1 ASP A 23 ? ASP A 28 ? ASP A 22 ASP A 27 AC 2 LEU A 31 ? PHE A 38 ? LEU A 30 PHE A 37 AC 3 GLY A 89 ? THR A 90 ? GLY A 88 THR A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ASP A 13 ? N ASP A 12 O THR A 226 ? O THR A 225 AA 2 3 N ILE A 231 ? N ILE A 230 O LEU A 181 ? O LEU A 180 AA 3 4 N LEU A 182 ? N LEU A 181 O TYR A 116 ? O TYR A 115 AA 4 5 N ARG A 119 ? N ARG A 118 O HIS A 122 ? O HIS A 121 AB 1 2 N ASP A 28 ? N ASP A 27 O LEU A 31 ? O LEU A 30 AB 2 3 N VAL A 34 ? N VAL A 33 O THR A 93 ? O THR A 92 AB 3 4 N ALA A 96 ? N ALA A 95 O LEU A 106 ? O LEU A 105 AB 4 5 N ASN A 109 ? N ASN A 108 O ASP A 169 ? O ASP A 168 AC 1 2 N ASP A 28 ? N ASP A 27 O LEU A 31 ? O LEU A 30 AC 2 3 N PHE A 38 ? N PHE A 37 O GLY A 89 ? O GLY A 88 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A1234' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A1235' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A1237' AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A1236' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 36 ? ASP A 35 . ? 1_555 ? 2 AC1 6 ASP A 186 ? ASP A 185 . ? 1_555 ? 3 AC1 6 ASP A 224 ? ASP A 223 . ? 1_555 ? 4 AC1 6 HOH F . ? HOH A 2322 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 2379 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 2381 . ? 1_555 ? 7 AC2 6 ASP A 36 ? ASP A 35 . ? 1_555 ? 8 AC2 6 GLY A 37 ? GLY A 36 . ? 1_555 ? 9 AC2 6 HOH F . ? HOH A 2063 . ? 1_555 ? 10 AC2 6 HOH F . ? HOH A 2070 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 2098 . ? 1_555 ? 12 AC2 6 HOH F . ? HOH A 2379 . ? 1_555 ? 13 AC3 6 HOH F . ? HOH A 2163 . ? 1_555 ? 14 AC3 6 HOH F . ? HOH A 2164 . ? 1_555 ? 15 AC3 6 HOH F . ? HOH A 2336 . ? 1_555 ? 16 AC3 6 HOH F . ? HOH A 2342 . ? 1_555 ? 17 AC3 6 HOH F . ? HOH A 2343 . ? 1_555 ? 18 AC3 6 HOH F . ? HOH A 2357 . ? 1_555 ? 19 AC4 1 HOH F . ? HOH A 2380 . ? 1_555 ? # _database_PDB_matrix.entry_id 2V06 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2V06 _atom_sites.fract_transf_matrix[1][1] 0.013384 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011962 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029728 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 ALA 3 2 2 ALA ALA A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 VAL 5 4 4 VAL VAL A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 SER 7 6 6 SER SER A . n A 1 8 ALA 8 7 7 ALA ALA A . n A 1 9 ALA 9 8 8 ALA ALA A . n A 1 10 THR 10 9 9 THR THR A . n A 1 11 ALA 11 10 10 ALA ALA A . n A 1 12 THR 12 11 11 THR THR A . n A 1 13 ASP 13 12 12 ASP ASP A . n A 1 14 GLN 14 13 13 GLN GLN A . n A 1 15 GLY 15 14 14 GLY GLY A . n A 1 16 PRO 16 15 15 PRO PRO A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 ASN 20 19 19 ASN ASN A . n A 1 21 ASN 21 20 20 ASN ASN A . n A 1 22 GLN 22 21 21 GLN GLN A . n A 1 23 ASP 23 22 22 ASP ASP A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 CYS 25 24 24 CYS CYS A . n A 1 26 LEU 26 25 25 LEU LEU A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 ASP 28 27 27 ASP ASP A . n A 1 29 GLY 29 28 28 GLY GLY A . n A 1 30 ILE 30 29 29 ILE ILE A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 TYR 32 31 31 TYR TYR A . n A 1 33 ALA 33 32 32 ALA ALA A . n A 1 34 VAL 34 33 33 VAL VAL A . n A 1 35 ALA 35 34 34 ALA ALA A . n A 1 36 ASP 36 35 35 ASP ASP A . n A 1 37 GLY 37 36 36 GLY GLY A . n A 1 38 PHE 38 37 37 PHE PHE A . n A 1 39 GLY 39 38 38 GLY GLY A . n A 1 40 ALA 40 39 39 ALA ALA A . n A 1 41 ARG 41 40 40 ARG ARG A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 HIS 43 42 42 HIS HIS A . n A 1 44 HIS 44 43 43 HIS HIS A . n A 1 45 ALA 45 44 44 ALA ALA A . n A 1 46 SER 46 45 45 SER SER A . n A 1 47 ALA 47 46 46 ALA ALA A . n A 1 48 THR 48 47 47 THR THR A . n A 1 49 ALA 49 48 48 ALA ALA A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 SER 54 53 53 SER SER A . n A 1 55 ALA 55 54 54 ALA ALA A . n A 1 56 GLY 56 55 55 GLY GLY A . n A 1 57 PHE 57 56 56 PHE PHE A . n A 1 58 ALA 58 57 57 ALA ALA A . n A 1 59 ALA 59 58 58 ALA ALA A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 PRO 61 60 60 PRO PRO A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 ARG 63 62 62 ARG ARG A . n A 1 64 ASP 64 63 63 ASP ASP A . n A 1 65 GLY 65 64 64 GLY GLY A . n A 1 66 LEU 66 65 65 LEU LEU A . n A 1 67 LEU 67 66 66 LEU LEU A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 GLN 71 70 70 GLN GLN A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 ALA 73 72 72 ALA ALA A . n A 1 74 ASN 74 73 73 ASN ASN A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 ARG 76 75 75 ARG ARG A . n A 1 77 VAL 77 76 76 VAL VAL A . n A 1 78 PHE 78 77 77 PHE PHE A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 LEU 80 79 79 LEU LEU A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 GLY 82 81 81 GLY GLY A . n A 1 83 ASP 83 82 82 ASP ASP A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 PRO 85 84 84 PRO PRO A . n A 1 86 THR 86 85 85 THR THR A . n A 1 87 VAL 87 86 86 VAL VAL A . n A 1 88 SER 88 87 87 SER SER A . n A 1 89 GLY 89 88 88 GLY GLY A . n A 1 90 THR 90 89 89 THR THR A . n A 1 91 THR 91 90 90 THR THR A . n A 1 92 LEU 92 91 91 LEU LEU A . n A 1 93 THR 93 92 92 THR THR A . n A 1 94 ALA 94 93 93 ALA ALA A . n A 1 95 VAL 95 94 94 VAL VAL A . n A 1 96 ALA 96 95 95 ALA ALA A . n A 1 97 VAL 97 96 96 VAL VAL A . n A 1 98 PHE 98 97 97 PHE PHE A . n A 1 99 GLU 99 98 98 GLU GLU A . n A 1 100 PRO 100 99 99 PRO PRO A . n A 1 101 GLY 101 100 100 GLY GLY A . n A 1 102 GLN 102 101 101 GLN GLN A . n A 1 103 GLY 103 102 102 GLY GLY A . n A 1 104 GLY 104 103 103 GLY GLY A . n A 1 105 PRO 105 104 104 PRO PRO A . n A 1 106 LEU 106 105 105 LEU LEU A . n A 1 107 VAL 107 106 106 VAL VAL A . n A 1 108 VAL 108 107 107 VAL VAL A . n A 1 109 ASN 109 108 108 ASN ASN A . n A 1 110 ILE 110 109 109 ILE ILE A . n A 1 111 GLY 111 110 110 GLY GLY A . n A 1 112 ASP 112 111 111 ASP ASP A . n A 1 113 SER 113 112 112 SER SER A . n A 1 114 PRO 114 113 113 PRO PRO A . n A 1 115 LEU 115 114 114 LEU LEU A . n A 1 116 TYR 116 115 115 TYR TYR A . n A 1 117 ARG 117 116 116 ARG ARG A . n A 1 118 ILE 118 117 117 ILE ILE A . n A 1 119 ARG 119 118 118 ARG ARG A . n A 1 120 ASP 120 119 119 ASP ASP A . n A 1 121 GLY 121 120 120 GLY GLY A . n A 1 122 HIS 122 121 121 HIS HIS A . n A 1 123 MET 123 122 122 MET MET A . n A 1 124 GLU 124 123 123 GLU GLU A . n A 1 125 GLN 125 124 124 GLN GLN A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 THR 127 126 126 THR THR A . n A 1 128 ASP 128 127 127 ASP ASP A . n A 1 129 ASP 129 128 128 ASP ASP A . n A 1 130 HIS 130 129 129 HIS HIS A . n A 1 131 SER 131 130 130 SER SER A . n A 1 132 VAL 132 131 131 VAL VAL A . n A 1 133 ALA 133 132 132 ALA ALA A . n A 1 134 GLY 134 133 133 GLY GLY A . n A 1 135 GLU 135 134 134 GLU GLU A . n A 1 136 LEU 136 135 135 LEU LEU A . n A 1 137 VAL 137 136 136 VAL VAL A . n A 1 138 ARG 138 137 137 ARG ARG A . n A 1 139 MET 139 138 138 MET MET A . n A 1 140 GLY 140 139 139 GLY GLY A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 ILE 142 141 141 ILE ILE A . n A 1 143 THR 143 142 142 THR THR A . n A 1 144 ARG 144 143 143 ARG ARG A . n A 1 145 HIS 145 144 144 HIS HIS A . n A 1 146 GLU 146 145 145 GLU GLU A . n A 1 147 ALA 147 146 146 ALA ALA A . n A 1 148 ARG 148 147 147 ARG ARG A . n A 1 149 TRP 149 148 148 TRP TRP A . n A 1 150 HIS 150 149 149 HIS HIS A . n A 1 151 PRO 151 150 150 PRO PRO A . n A 1 152 GLN 152 151 151 GLN GLN A . n A 1 153 ARG 153 152 152 ARG ARG A . n A 1 154 HIS 154 153 153 HIS HIS A . n A 1 155 LEU 155 154 154 LEU LEU A . n A 1 156 LEU 156 155 155 LEU LEU A . n A 1 157 THR 157 156 156 THR THR A . n A 1 158 ARG 158 157 157 ARG ARG A . n A 1 159 ALA 159 158 158 ALA ALA A . n A 1 160 LEU 160 159 159 LEU LEU A . n A 1 161 GLY 161 160 160 GLY GLY A . n A 1 162 ILE 162 161 161 ILE ILE A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 PRO 164 163 163 PRO PRO A . n A 1 165 HIS 165 164 164 HIS HIS A . n A 1 166 ILE 166 165 165 ILE ILE A . n A 1 167 GLY 167 166 166 GLY GLY A . n A 1 168 PRO 168 167 167 PRO PRO A . n A 1 169 ASP 169 168 168 ASP ASP A . n A 1 170 VAL 170 169 169 VAL VAL A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 GLY 172 171 171 GLY GLY A . n A 1 173 ILE 173 172 172 ILE ILE A . n A 1 174 ASP 174 173 173 ASP ASP A . n A 1 175 CYS 175 174 174 CYS CYS A . n A 1 176 GLY 176 175 175 GLY GLY A . n A 1 177 PRO 177 176 176 PRO PRO A . n A 1 178 GLY 178 177 177 GLY GLY A . n A 1 179 ASP 179 178 178 ASP ASP A . n A 1 180 ARG 180 179 179 ARG ARG A . n A 1 181 LEU 181 180 180 LEU LEU A . n A 1 182 LEU 182 181 181 LEU LEU A . n A 1 183 ILE 183 182 182 ILE ILE A . n A 1 184 SER 184 183 183 SER SER A . n A 1 185 SER 185 184 184 SER SER A . n A 1 186 ASP 186 185 185 ASP ASP A . n A 1 187 GLY 187 186 186 GLY GLY A . n A 1 188 LEU 188 187 187 LEU LEU A . n A 1 189 PHE 189 188 188 PHE PHE A . n A 1 190 ALA 190 189 189 ALA ALA A . n A 1 191 ALA 191 190 190 ALA ALA A . n A 1 192 ALA 192 191 191 ALA ALA A . n A 1 193 ASP 193 192 192 ASP ASP A . n A 1 194 GLU 194 193 193 GLU GLU A . n A 1 195 ALA 195 194 194 ALA ALA A . n A 1 196 LEU 196 195 195 LEU LEU A . n A 1 197 ILE 197 196 196 ILE ILE A . n A 1 198 VAL 198 197 197 VAL VAL A . n A 1 199 ASP 199 198 198 ASP ASP A . n A 1 200 ALA 200 199 199 ALA ALA A . n A 1 201 ALA 201 200 200 ALA ALA A . n A 1 202 THR 202 201 201 THR THR A . n A 1 203 SER 203 202 202 SER SER A . n A 1 204 PRO 204 203 203 PRO PRO A . n A 1 205 ASP 205 204 204 ASP ASP A . n A 1 206 PRO 206 205 205 PRO PRO A . n A 1 207 GLN 207 206 206 GLN GLN A . n A 1 208 VAL 208 207 207 VAL VAL A . n A 1 209 ALA 209 208 208 ALA ALA A . n A 1 210 VAL 210 209 209 VAL VAL A . n A 1 211 ARG 211 210 210 ARG ARG A . n A 1 212 ARG 212 211 211 ARG ARG A . n A 1 213 LEU 213 212 212 LEU LEU A . n A 1 214 VAL 214 213 213 VAL VAL A . n A 1 215 GLU 215 214 214 GLU GLU A . n A 1 216 VAL 216 215 215 VAL VAL A . n A 1 217 ALA 217 216 216 ALA ALA A . n A 1 218 ASN 218 217 217 ASN ASN A . n A 1 219 ASP 219 218 218 ASP ASP A . n A 1 220 ALA 220 219 219 ALA ALA A . n A 1 221 GLY 221 220 220 GLY GLY A . n A 1 222 GLY 222 221 221 GLY GLY A . n A 1 223 SER 223 222 222 SER SER A . n A 1 224 ASP 224 223 223 ASP ASP A . n A 1 225 ASN 225 224 224 ASN ASN A . n A 1 226 THR 226 225 225 THR THR A . n A 1 227 THR 227 226 226 THR THR A . n A 1 228 VAL 228 227 227 VAL VAL A . n A 1 229 VAL 229 228 228 VAL VAL A . n A 1 230 VAL 230 229 229 VAL VAL A . n A 1 231 ILE 231 230 230 ILE ILE A . n A 1 232 ASP 232 231 231 ASP ASP A . n A 1 233 LEU 233 232 232 LEU LEU A . n A 1 234 GLY 234 233 233 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 1234 1234 MG MG A . C 2 MG 1 1235 1235 MG MG A . D 3 CL 1 1236 1236 CL CL A . E 2 MG 1 1237 1237 MG MG A . F 4 HOH 1 2001 2001 HOH HOH A . F 4 HOH 2 2002 2002 HOH HOH A . F 4 HOH 3 2003 2003 HOH HOH A . F 4 HOH 4 2004 2004 HOH HOH A . F 4 HOH 5 2005 2005 HOH HOH A . F 4 HOH 6 2006 2006 HOH HOH A . F 4 HOH 7 2007 2007 HOH HOH A . F 4 HOH 8 2008 2008 HOH HOH A . F 4 HOH 9 2009 2009 HOH HOH A . F 4 HOH 10 2010 2010 HOH HOH A . F 4 HOH 11 2011 2011 HOH HOH A . F 4 HOH 12 2012 2012 HOH HOH A . F 4 HOH 13 2013 2013 HOH HOH A . F 4 HOH 14 2014 2014 HOH HOH A . F 4 HOH 15 2015 2015 HOH HOH A . F 4 HOH 16 2016 2016 HOH HOH A . F 4 HOH 17 2017 2017 HOH HOH A . F 4 HOH 18 2018 2018 HOH HOH A . F 4 HOH 19 2019 2019 HOH HOH A . F 4 HOH 20 2020 2020 HOH HOH A . F 4 HOH 21 2021 2021 HOH HOH A . F 4 HOH 22 2022 2022 HOH HOH A . F 4 HOH 23 2023 2023 HOH HOH A . F 4 HOH 24 2024 2024 HOH HOH A . F 4 HOH 25 2025 2025 HOH HOH A . F 4 HOH 26 2026 2026 HOH HOH A . F 4 HOH 27 2027 2027 HOH HOH A . F 4 HOH 28 2028 2028 HOH HOH A . F 4 HOH 29 2029 2029 HOH HOH A . F 4 HOH 30 2030 2030 HOH HOH A . F 4 HOH 31 2031 2031 HOH HOH A . F 4 HOH 32 2032 2032 HOH HOH A . F 4 HOH 33 2033 2033 HOH HOH A . F 4 HOH 34 2034 2034 HOH HOH A . F 4 HOH 35 2035 2035 HOH HOH A . F 4 HOH 36 2036 2036 HOH HOH A . F 4 HOH 37 2037 2037 HOH HOH A . F 4 HOH 38 2038 2038 HOH HOH A . F 4 HOH 39 2039 2039 HOH HOH A . F 4 HOH 40 2040 2040 HOH HOH A . F 4 HOH 41 2041 2041 HOH HOH A . F 4 HOH 42 2042 2042 HOH HOH A . F 4 HOH 43 2043 2043 HOH HOH A . F 4 HOH 44 2044 2044 HOH HOH A . F 4 HOH 45 2045 2045 HOH HOH A . F 4 HOH 46 2046 2046 HOH HOH A . F 4 HOH 47 2047 2047 HOH HOH A . F 4 HOH 48 2048 2048 HOH HOH A . F 4 HOH 49 2049 2049 HOH HOH A . F 4 HOH 50 2050 2050 HOH HOH A . F 4 HOH 51 2051 2051 HOH HOH A . F 4 HOH 52 2052 2052 HOH HOH A . F 4 HOH 53 2053 2053 HOH HOH A . F 4 HOH 54 2054 2054 HOH HOH A . F 4 HOH 55 2055 2055 HOH HOH A . F 4 HOH 56 2056 2056 HOH HOH A . F 4 HOH 57 2057 2057 HOH HOH A . F 4 HOH 58 2058 2058 HOH HOH A . F 4 HOH 59 2059 2059 HOH HOH A . F 4 HOH 60 2060 2060 HOH HOH A . F 4 HOH 61 2061 2061 HOH HOH A . F 4 HOH 62 2062 2062 HOH HOH A . F 4 HOH 63 2063 2063 HOH HOH A . F 4 HOH 64 2064 2064 HOH HOH A . F 4 HOH 65 2065 2065 HOH HOH A . F 4 HOH 66 2066 2066 HOH HOH A . F 4 HOH 67 2067 2067 HOH HOH A . F 4 HOH 68 2068 2068 HOH HOH A . F 4 HOH 69 2069 2069 HOH HOH A . F 4 HOH 70 2070 2070 HOH HOH A . F 4 HOH 71 2071 2071 HOH HOH A . F 4 HOH 72 2072 2072 HOH HOH A . F 4 HOH 73 2073 2073 HOH HOH A . F 4 HOH 74 2074 2074 HOH HOH A . F 4 HOH 75 2075 2075 HOH HOH A . F 4 HOH 76 2076 2076 HOH HOH A . F 4 HOH 77 2077 2077 HOH HOH A . F 4 HOH 78 2078 2078 HOH HOH A . F 4 HOH 79 2079 2079 HOH HOH A . F 4 HOH 80 2080 2080 HOH HOH A . F 4 HOH 81 2081 2081 HOH HOH A . F 4 HOH 82 2082 2082 HOH HOH A . F 4 HOH 83 2083 2083 HOH HOH A . F 4 HOH 84 2084 2084 HOH HOH A . F 4 HOH 85 2085 2085 HOH HOH A . F 4 HOH 86 2086 2086 HOH HOH A . F 4 HOH 87 2087 2087 HOH HOH A . F 4 HOH 88 2088 2088 HOH HOH A . F 4 HOH 89 2089 2089 HOH HOH A . F 4 HOH 90 2090 2090 HOH HOH A . F 4 HOH 91 2091 2091 HOH HOH A . F 4 HOH 92 2092 2092 HOH HOH A . F 4 HOH 93 2093 2093 HOH HOH A . F 4 HOH 94 2094 2094 HOH HOH A . F 4 HOH 95 2095 2095 HOH HOH A . F 4 HOH 96 2096 2096 HOH HOH A . F 4 HOH 97 2097 2097 HOH HOH A . F 4 HOH 98 2098 2098 HOH HOH A . F 4 HOH 99 2099 2099 HOH HOH A . F 4 HOH 100 2100 2100 HOH HOH A . F 4 HOH 101 2101 2101 HOH HOH A . F 4 HOH 102 2102 2102 HOH HOH A . F 4 HOH 103 2103 2103 HOH HOH A . F 4 HOH 104 2104 2104 HOH HOH A . F 4 HOH 105 2105 2105 HOH HOH A . F 4 HOH 106 2106 2106 HOH HOH A . F 4 HOH 107 2107 2107 HOH HOH A . F 4 HOH 108 2108 2108 HOH HOH A . F 4 HOH 109 2109 2109 HOH HOH A . F 4 HOH 110 2110 2110 HOH HOH A . F 4 HOH 111 2111 2111 HOH HOH A . F 4 HOH 112 2112 2112 HOH HOH A . F 4 HOH 113 2113 2113 HOH HOH A . F 4 HOH 114 2114 2114 HOH HOH A . F 4 HOH 115 2115 2115 HOH HOH A . F 4 HOH 116 2116 2116 HOH HOH A . F 4 HOH 117 2117 2117 HOH HOH A . F 4 HOH 118 2118 2118 HOH HOH A . F 4 HOH 119 2119 2119 HOH HOH A . F 4 HOH 120 2120 2120 HOH HOH A . F 4 HOH 121 2121 2121 HOH HOH A . F 4 HOH 122 2122 2122 HOH HOH A . F 4 HOH 123 2123 2123 HOH HOH A . F 4 HOH 124 2124 2124 HOH HOH A . F 4 HOH 125 2125 2125 HOH HOH A . F 4 HOH 126 2126 2126 HOH HOH A . F 4 HOH 127 2127 2127 HOH HOH A . F 4 HOH 128 2128 2128 HOH HOH A . F 4 HOH 129 2129 2129 HOH HOH A . F 4 HOH 130 2130 2130 HOH HOH A . F 4 HOH 131 2131 2131 HOH HOH A . F 4 HOH 132 2132 2132 HOH HOH A . F 4 HOH 133 2133 2133 HOH HOH A . F 4 HOH 134 2134 2134 HOH HOH A . F 4 HOH 135 2135 2135 HOH HOH A . F 4 HOH 136 2136 2136 HOH HOH A . F 4 HOH 137 2137 2137 HOH HOH A . F 4 HOH 138 2138 2138 HOH HOH A . F 4 HOH 139 2139 2139 HOH HOH A . F 4 HOH 140 2140 2140 HOH HOH A . F 4 HOH 141 2141 2141 HOH HOH A . F 4 HOH 142 2142 2142 HOH HOH A . F 4 HOH 143 2143 2143 HOH HOH A . F 4 HOH 144 2144 2144 HOH HOH A . F 4 HOH 145 2145 2145 HOH HOH A . F 4 HOH 146 2146 2146 HOH HOH A . F 4 HOH 147 2147 2147 HOH HOH A . F 4 HOH 148 2148 2148 HOH HOH A . F 4 HOH 149 2149 2149 HOH HOH A . F 4 HOH 150 2150 2150 HOH HOH A . F 4 HOH 151 2151 2151 HOH HOH A . F 4 HOH 152 2152 2152 HOH HOH A . F 4 HOH 153 2153 2153 HOH HOH A . F 4 HOH 154 2154 2154 HOH HOH A . F 4 HOH 155 2155 2155 HOH HOH A . F 4 HOH 156 2156 2156 HOH HOH A . F 4 HOH 157 2157 2157 HOH HOH A . F 4 HOH 158 2158 2158 HOH HOH A . F 4 HOH 159 2159 2159 HOH HOH A . F 4 HOH 160 2160 2160 HOH HOH A . F 4 HOH 161 2161 2161 HOH HOH A . F 4 HOH 162 2162 2162 HOH HOH A . F 4 HOH 163 2163 2163 HOH HOH A . F 4 HOH 164 2164 2164 HOH HOH A . F 4 HOH 165 2165 2165 HOH HOH A . F 4 HOH 166 2166 2166 HOH HOH A . F 4 HOH 167 2167 2167 HOH HOH A . F 4 HOH 168 2168 2168 HOH HOH A . F 4 HOH 169 2169 2169 HOH HOH A . F 4 HOH 170 2170 2170 HOH HOH A . F 4 HOH 171 2171 2171 HOH HOH A . F 4 HOH 172 2172 2172 HOH HOH A . F 4 HOH 173 2173 2173 HOH HOH A . F 4 HOH 174 2174 2174 HOH HOH A . F 4 HOH 175 2175 2175 HOH HOH A . F 4 HOH 176 2176 2176 HOH HOH A . F 4 HOH 177 2177 2177 HOH HOH A . F 4 HOH 178 2178 2178 HOH HOH A . F 4 HOH 179 2179 2179 HOH HOH A . F 4 HOH 180 2180 2180 HOH HOH A . F 4 HOH 181 2181 2181 HOH HOH A . F 4 HOH 182 2182 2182 HOH HOH A . F 4 HOH 183 2183 2183 HOH HOH A . F 4 HOH 184 2184 2184 HOH HOH A . F 4 HOH 185 2185 2185 HOH HOH A . F 4 HOH 186 2186 2186 HOH HOH A . F 4 HOH 187 2187 2187 HOH HOH A . F 4 HOH 188 2188 2188 HOH HOH A . F 4 HOH 189 2189 2189 HOH HOH A . F 4 HOH 190 2190 2190 HOH HOH A . F 4 HOH 191 2191 2191 HOH HOH A . F 4 HOH 192 2192 2192 HOH HOH A . F 4 HOH 193 2193 2193 HOH HOH A . F 4 HOH 194 2194 2194 HOH HOH A . F 4 HOH 195 2195 2195 HOH HOH A . F 4 HOH 196 2196 2196 HOH HOH A . F 4 HOH 197 2197 2197 HOH HOH A . F 4 HOH 198 2198 2198 HOH HOH A . F 4 HOH 199 2199 2199 HOH HOH A . F 4 HOH 200 2200 2200 HOH HOH A . F 4 HOH 201 2201 2201 HOH HOH A . F 4 HOH 202 2202 2202 HOH HOH A . F 4 HOH 203 2203 2203 HOH HOH A . F 4 HOH 204 2204 2204 HOH HOH A . F 4 HOH 205 2205 2205 HOH HOH A . F 4 HOH 206 2206 2206 HOH HOH A . F 4 HOH 207 2207 2207 HOH HOH A . F 4 HOH 208 2208 2208 HOH HOH A . F 4 HOH 209 2209 2209 HOH HOH A . F 4 HOH 210 2210 2210 HOH HOH A . F 4 HOH 211 2211 2211 HOH HOH A . F 4 HOH 212 2212 2212 HOH HOH A . F 4 HOH 213 2213 2213 HOH HOH A . F 4 HOH 214 2214 2214 HOH HOH A . F 4 HOH 215 2215 2215 HOH HOH A . F 4 HOH 216 2216 2216 HOH HOH A . F 4 HOH 217 2217 2217 HOH HOH A . F 4 HOH 218 2218 2218 HOH HOH A . F 4 HOH 219 2219 2219 HOH HOH A . F 4 HOH 220 2220 2220 HOH HOH A . F 4 HOH 221 2221 2221 HOH HOH A . F 4 HOH 222 2222 2222 HOH HOH A . F 4 HOH 223 2223 2223 HOH HOH A . F 4 HOH 224 2224 2224 HOH HOH A . F 4 HOH 225 2225 2225 HOH HOH A . F 4 HOH 226 2226 2226 HOH HOH A . F 4 HOH 227 2227 2227 HOH HOH A . F 4 HOH 228 2228 2228 HOH HOH A . F 4 HOH 229 2229 2229 HOH HOH A . F 4 HOH 230 2230 2230 HOH HOH A . F 4 HOH 231 2231 2231 HOH HOH A . F 4 HOH 232 2232 2232 HOH HOH A . F 4 HOH 233 2233 2233 HOH HOH A . F 4 HOH 234 2234 2234 HOH HOH A . F 4 HOH 235 2235 2235 HOH HOH A . F 4 HOH 236 2236 2236 HOH HOH A . F 4 HOH 237 2237 2237 HOH HOH A . F 4 HOH 238 2238 2238 HOH HOH A . F 4 HOH 239 2239 2239 HOH HOH A . F 4 HOH 240 2240 2240 HOH HOH A . F 4 HOH 241 2241 2241 HOH HOH A . F 4 HOH 242 2242 2242 HOH HOH A . F 4 HOH 243 2243 2243 HOH HOH A . F 4 HOH 244 2244 2244 HOH HOH A . F 4 HOH 245 2245 2245 HOH HOH A . F 4 HOH 246 2246 2246 HOH HOH A . F 4 HOH 247 2247 2247 HOH HOH A . F 4 HOH 248 2248 2248 HOH HOH A . F 4 HOH 249 2249 2249 HOH HOH A . F 4 HOH 250 2250 2250 HOH HOH A . F 4 HOH 251 2251 2251 HOH HOH A . F 4 HOH 252 2252 2252 HOH HOH A . F 4 HOH 253 2253 2253 HOH HOH A . F 4 HOH 254 2254 2254 HOH HOH A . F 4 HOH 255 2255 2255 HOH HOH A . F 4 HOH 256 2256 2256 HOH HOH A . F 4 HOH 257 2257 2257 HOH HOH A . F 4 HOH 258 2258 2258 HOH HOH A . F 4 HOH 259 2259 2259 HOH HOH A . F 4 HOH 260 2260 2260 HOH HOH A . F 4 HOH 261 2261 2261 HOH HOH A . F 4 HOH 262 2262 2262 HOH HOH A . F 4 HOH 263 2263 2263 HOH HOH A . F 4 HOH 264 2264 2264 HOH HOH A . F 4 HOH 265 2265 2265 HOH HOH A . F 4 HOH 266 2266 2266 HOH HOH A . F 4 HOH 267 2267 2267 HOH HOH A . F 4 HOH 268 2268 2268 HOH HOH A . F 4 HOH 269 2269 2269 HOH HOH A . F 4 HOH 270 2270 2270 HOH HOH A . F 4 HOH 271 2271 2271 HOH HOH A . F 4 HOH 272 2272 2272 HOH HOH A . F 4 HOH 273 2273 2273 HOH HOH A . F 4 HOH 274 2274 2274 HOH HOH A . F 4 HOH 275 2275 2275 HOH HOH A . F 4 HOH 276 2276 2276 HOH HOH A . F 4 HOH 277 2277 2277 HOH HOH A . F 4 HOH 278 2278 2278 HOH HOH A . F 4 HOH 279 2279 2279 HOH HOH A . F 4 HOH 280 2280 2280 HOH HOH A . F 4 HOH 281 2281 2281 HOH HOH A . F 4 HOH 282 2282 2282 HOH HOH A . F 4 HOH 283 2283 2283 HOH HOH A . F 4 HOH 284 2284 2284 HOH HOH A . F 4 HOH 285 2285 2285 HOH HOH A . F 4 HOH 286 2286 2286 HOH HOH A . F 4 HOH 287 2287 2287 HOH HOH A . F 4 HOH 288 2288 2288 HOH HOH A . F 4 HOH 289 2289 2289 HOH HOH A . F 4 HOH 290 2290 2290 HOH HOH A . F 4 HOH 291 2291 2291 HOH HOH A . F 4 HOH 292 2292 2292 HOH HOH A . F 4 HOH 293 2293 2293 HOH HOH A . F 4 HOH 294 2294 2294 HOH HOH A . F 4 HOH 295 2295 2295 HOH HOH A . F 4 HOH 296 2296 2296 HOH HOH A . F 4 HOH 297 2297 2297 HOH HOH A . F 4 HOH 298 2298 2298 HOH HOH A . F 4 HOH 299 2299 2299 HOH HOH A . F 4 HOH 300 2300 2300 HOH HOH A . F 4 HOH 301 2301 2301 HOH HOH A . F 4 HOH 302 2302 2302 HOH HOH A . F 4 HOH 303 2303 2303 HOH HOH A . F 4 HOH 304 2304 2304 HOH HOH A . F 4 HOH 305 2305 2305 HOH HOH A . F 4 HOH 306 2306 2306 HOH HOH A . F 4 HOH 307 2307 2307 HOH HOH A . F 4 HOH 308 2308 2308 HOH HOH A . F 4 HOH 309 2309 2309 HOH HOH A . F 4 HOH 310 2310 2310 HOH HOH A . F 4 HOH 311 2311 2311 HOH HOH A . F 4 HOH 312 2312 2312 HOH HOH A . F 4 HOH 313 2313 2313 HOH HOH A . F 4 HOH 314 2314 2314 HOH HOH A . F 4 HOH 315 2315 2315 HOH HOH A . F 4 HOH 316 2316 2316 HOH HOH A . F 4 HOH 317 2317 2317 HOH HOH A . F 4 HOH 318 2318 2318 HOH HOH A . F 4 HOH 319 2319 2319 HOH HOH A . F 4 HOH 320 2320 2320 HOH HOH A . F 4 HOH 321 2321 2321 HOH HOH A . F 4 HOH 322 2322 2322 HOH HOH A . F 4 HOH 323 2323 2323 HOH HOH A . F 4 HOH 324 2324 2324 HOH HOH A . F 4 HOH 325 2325 2325 HOH HOH A . F 4 HOH 326 2326 2326 HOH HOH A . F 4 HOH 327 2327 2327 HOH HOH A . F 4 HOH 328 2328 2328 HOH HOH A . F 4 HOH 329 2329 2329 HOH HOH A . F 4 HOH 330 2330 2330 HOH HOH A . F 4 HOH 331 2331 2331 HOH HOH A . F 4 HOH 332 2332 2332 HOH HOH A . F 4 HOH 333 2333 2333 HOH HOH A . F 4 HOH 334 2334 2334 HOH HOH A . F 4 HOH 335 2335 2335 HOH HOH A . F 4 HOH 336 2336 2336 HOH HOH A . F 4 HOH 337 2337 2337 HOH HOH A . F 4 HOH 338 2338 2338 HOH HOH A . F 4 HOH 339 2339 2339 HOH HOH A . F 4 HOH 340 2340 2340 HOH HOH A . F 4 HOH 341 2341 2341 HOH HOH A . F 4 HOH 342 2342 2342 HOH HOH A . F 4 HOH 343 2343 2343 HOH HOH A . F 4 HOH 344 2344 2344 HOH HOH A . F 4 HOH 345 2345 2345 HOH HOH A . F 4 HOH 346 2346 2346 HOH HOH A . F 4 HOH 347 2347 2347 HOH HOH A . F 4 HOH 348 2348 2348 HOH HOH A . F 4 HOH 349 2349 2349 HOH HOH A . F 4 HOH 350 2350 2350 HOH HOH A . F 4 HOH 351 2351 2351 HOH HOH A . F 4 HOH 352 2352 2352 HOH HOH A . F 4 HOH 353 2353 2353 HOH HOH A . F 4 HOH 354 2354 2354 HOH HOH A . F 4 HOH 355 2355 2355 HOH HOH A . F 4 HOH 356 2356 2356 HOH HOH A . F 4 HOH 357 2357 2357 HOH HOH A . F 4 HOH 358 2358 2358 HOH HOH A . F 4 HOH 359 2359 2359 HOH HOH A . F 4 HOH 360 2360 2360 HOH HOH A . F 4 HOH 361 2361 2361 HOH HOH A . F 4 HOH 362 2362 2362 HOH HOH A . F 4 HOH 363 2363 2363 HOH HOH A . F 4 HOH 364 2364 2364 HOH HOH A . F 4 HOH 365 2365 2365 HOH HOH A . F 4 HOH 366 2366 2366 HOH HOH A . F 4 HOH 367 2367 2367 HOH HOH A . F 4 HOH 368 2368 2368 HOH HOH A . F 4 HOH 369 2369 2369 HOH HOH A . F 4 HOH 370 2370 2370 HOH HOH A . F 4 HOH 371 2371 2371 HOH HOH A . F 4 HOH 372 2372 2372 HOH HOH A . F 4 HOH 373 2373 2373 HOH HOH A . F 4 HOH 374 2374 2374 HOH HOH A . F 4 HOH 375 2375 2375 HOH HOH A . F 4 HOH 376 2376 2376 HOH HOH A . F 4 HOH 377 2377 2377 HOH HOH A . F 4 HOH 378 2378 2378 HOH HOH A . F 4 HOH 379 2379 2379 HOH HOH A . F 4 HOH 380 2380 2380 HOH HOH A . F 4 HOH 381 2381 2381 HOH HOH A . F 4 HOH 382 2382 2382 HOH HOH A . F 4 HOH 383 2383 2383 HOH HOH A . F 4 HOH 384 2384 2384 HOH HOH A . F 4 HOH 385 2385 2385 HOH HOH A . F 4 HOH 386 2386 2386 HOH HOH A . F 4 HOH 387 2387 2387 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? F HOH . ? A HOH 2381 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD1 A A ASP 186 ? A ASP 185 ? 1_555 99.9 ? 2 O ? F HOH . ? A HOH 2381 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD1 B A ASP 186 ? A ASP 185 ? 1_555 95.1 ? 3 OD1 A A ASP 186 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD1 B A ASP 186 ? A ASP 185 ? 1_555 8.0 ? 4 O ? F HOH . ? A HOH 2381 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD2 ? A ASP 36 ? A ASP 35 ? 1_555 84.6 ? 5 OD1 A A ASP 186 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD2 ? A ASP 36 ? A ASP 35 ? 1_555 85.6 ? 6 OD1 B A ASP 186 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD2 ? A ASP 36 ? A ASP 35 ? 1_555 91.5 ? 7 O ? F HOH . ? A HOH 2381 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD2 ? A ASP 224 ? A ASP 223 ? 1_555 86.5 ? 8 OD1 A A ASP 186 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD2 ? A ASP 224 ? A ASP 223 ? 1_555 90.3 ? 9 OD1 B A ASP 186 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD2 ? A ASP 224 ? A ASP 223 ? 1_555 83.6 ? 10 OD2 ? A ASP 36 ? A ASP 35 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 OD2 ? A ASP 224 ? A ASP 223 ? 1_555 169.4 ? 11 O ? F HOH . ? A HOH 2381 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2322 ? 1_555 174.1 ? 12 OD1 A A ASP 186 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2322 ? 1_555 84.8 ? 13 OD1 B A ASP 186 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2322 ? 1_555 90.0 ? 14 OD2 ? A ASP 36 ? A ASP 35 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2322 ? 1_555 92.3 ? 15 OD2 ? A ASP 224 ? A ASP 223 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2322 ? 1_555 97.0 ? 16 O ? F HOH . ? A HOH 2381 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 90.6 ? 17 OD1 A A ASP 186 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 168.3 ? 18 OD1 B A ASP 186 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 167.2 ? 19 OD2 ? A ASP 36 ? A ASP 35 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 100.5 ? 20 OD2 ? A ASP 224 ? A ASP 223 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 85.3 ? 21 O ? F HOH . ? A HOH 2322 ? 1_555 MG ? B MG . ? A MG 1234 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 84.9 ? 22 O ? A GLY 37 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2063 ? 1_555 85.7 ? 23 O ? A GLY 37 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2070 ? 1_555 101.1 ? 24 O ? F HOH . ? A HOH 2063 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2070 ? 1_555 89.4 ? 25 O ? A GLY 37 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2098 ? 1_555 85.8 ? 26 O ? F HOH . ? A HOH 2063 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2098 ? 1_555 96.1 ? 27 O ? F HOH . ? A HOH 2070 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2098 ? 1_555 171.6 ? 28 O ? A GLY 37 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 168.0 ? 29 O ? F HOH . ? A HOH 2063 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 90.9 ? 30 O ? F HOH . ? A HOH 2070 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 90.4 ? 31 O ? F HOH . ? A HOH 2098 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 O ? F HOH . ? A HOH 2379 ? 1_555 83.2 ? 32 O ? A GLY 37 ? A GLY 36 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 OD1 ? A ASP 36 ? A ASP 35 ? 1_555 91.7 ? 33 O ? F HOH . ? A HOH 2063 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 OD1 ? A ASP 36 ? A ASP 35 ? 1_555 171.9 ? 34 O ? F HOH . ? A HOH 2070 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 OD1 ? A ASP 36 ? A ASP 35 ? 1_555 83.6 ? 35 O ? F HOH . ? A HOH 2098 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 OD1 ? A ASP 36 ? A ASP 35 ? 1_555 91.3 ? 36 O ? F HOH . ? A HOH 2379 ? 1_555 MG ? C MG . ? A MG 1235 ? 1_555 OD1 ? A ASP 36 ? A ASP 35 ? 1_555 93.1 ? 37 O ? F HOH . ? A HOH 2343 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2357 ? 3_656 89.9 ? 38 O ? F HOH . ? A HOH 2343 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2336 ? 3_656 92.1 ? 39 O ? F HOH . ? A HOH 2357 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2336 ? 3_656 96.3 ? 40 O ? F HOH . ? A HOH 2343 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2342 ? 3_656 88.1 ? 41 O ? F HOH . ? A HOH 2357 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2342 ? 3_656 91.5 ? 42 O ? F HOH . ? A HOH 2336 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2342 ? 3_656 172.3 ? 43 O ? F HOH . ? A HOH 2343 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2163 ? 3_656 91.8 ? 44 O ? F HOH . ? A HOH 2357 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2163 ? 3_656 175.4 ? 45 O ? F HOH . ? A HOH 2336 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2163 ? 3_656 88.0 ? 46 O ? F HOH . ? A HOH 2342 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2163 ? 3_656 84.3 ? 47 O ? F HOH . ? A HOH 2343 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2164 ? 3_656 177.5 ? 48 O ? F HOH . ? A HOH 2357 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2164 ? 3_656 90.6 ? 49 O ? F HOH . ? A HOH 2336 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2164 ? 3_656 90.2 ? 50 O ? F HOH . ? A HOH 2342 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2164 ? 3_656 89.5 ? 51 O ? F HOH . ? A HOH 2163 ? 3_656 MG ? E MG . ? A MG 1237 ? 1_555 O ? F HOH . ? A HOH 2164 ? 3_656 87.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-16 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-05-22 5 'Structure model' 1 4 2019-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' Other 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_proc 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' refine 4 5 'Structure model' diffrn_source # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 2 4 'Structure model' '_refine.pdbx_ls_cross_valid_method' 3 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHELXL-97 refinement . ? 1 XDS 'data reduction' . ? 2 XSCALE 'data scaling' . ? 3 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ; SHEET THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW, TWO SHEETS ARE DEFINED. ; # _pdbx_entry_details.entry_id 2V06 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'RESIDUE GLY0 IS A CLONING ARTIFACT' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 24 ? B CB A CYS 24 ? B SG A CYS 24 ? B 99.58 114.00 -14.42 1.80 N 2 1 CD A ARG 40 ? B NE A ARG 40 ? B CZ A ARG 40 ? B 152.59 123.60 28.99 1.40 N 3 1 NE A ARG 40 ? A CZ A ARG 40 ? A NH1 A ARG 40 ? A 124.93 120.30 4.63 0.50 N 4 1 NE A ARG 40 ? A CZ A ARG 40 ? A NH2 A ARG 40 ? A 115.26 120.30 -5.04 0.50 N 5 1 NE A ARG 40 ? B CZ A ARG 40 ? B NH2 A ARG 40 ? B 124.60 120.30 4.30 0.50 N 6 1 CB A ASP 61 ? ? CG A ASP 61 ? ? OD1 A ASP 61 ? ? 124.47 118.30 6.17 0.90 N 7 1 CA A GLU 67 ? B CB A GLU 67 ? B CG A GLU 67 ? B 127.21 113.40 13.81 2.20 N 8 1 CB A GLU 67 ? A CG A GLU 67 ? A CD A GLU 67 ? A 135.62 114.20 21.42 2.70 N 9 1 CB A TYR 115 ? A CG A TYR 115 ? A CD1 A TYR 115 ? A 117.36 121.00 -3.64 0.60 N 10 1 NE A ARG 116 ? ? CZ A ARG 116 ? ? NH2 A ARG 116 ? ? 113.94 120.30 -6.36 0.50 N 11 1 NE A ARG 118 ? ? CZ A ARG 118 ? ? NH2 A ARG 118 ? ? 116.29 120.30 -4.01 0.50 N 12 1 CG A HIS 129 ? ? ND1 A HIS 129 ? ? CE1 A HIS 129 ? ? 117.16 109.00 8.16 1.00 N 13 1 NE A ARG 137 ? A CZ A ARG 137 ? A NH2 A ARG 137 ? A 115.39 120.30 -4.91 0.50 N 14 1 NE A ARG 137 ? B CZ A ARG 137 ? B NH2 A ARG 137 ? B 114.57 120.30 -5.73 0.50 N 15 1 CG A ARG 147 ? ? CD A ARG 147 ? ? NE A ARG 147 ? ? 124.71 111.80 12.91 2.10 N 16 1 CA A TRP 148 ? ? CB A TRP 148 ? ? CG A TRP 148 ? ? 126.20 113.70 12.50 1.90 N 17 1 CB A TRP 148 ? ? CG A TRP 148 ? ? CD2 A TRP 148 ? ? 115.26 126.60 -11.34 1.30 N 18 1 CB A TRP 148 ? ? CG A TRP 148 ? ? CD1 A TRP 148 ? ? 138.71 127.00 11.71 1.30 N 19 1 NE A ARG 157 ? ? CZ A ARG 157 ? ? NH1 A ARG 157 ? ? 115.68 120.30 -4.62 0.50 N 20 1 CB A PHE 170 ? ? CG A PHE 170 ? ? CD1 A PHE 170 ? ? 114.46 120.80 -6.34 0.70 N 21 1 NE A ARG 179 ? ? CZ A ARG 179 ? ? NH2 A ARG 179 ? ? 117.22 120.30 -3.08 0.50 N 22 1 NE A ARG 210 ? B CZ A ARG 210 ? B NH1 A ARG 210 ? B 115.36 120.30 -4.94 0.50 N 23 1 NE A ARG 210 ? A CZ A ARG 210 ? A NH2 A ARG 210 ? A 124.17 120.30 3.87 0.50 N 24 1 NE A ARG 211 ? ? CZ A ARG 211 ? ? NH1 A ARG 211 ? ? 123.76 120.30 3.46 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 59 ? ? -152.97 74.28 2 1 ALA A 190 ? ? -154.85 -27.89 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2015 ? 5.88 . 2 1 O ? A HOH 2031 ? 7.34 . 3 1 O ? A HOH 2032 ? 6.74 . 4 1 O ? A HOH 2042 ? 6.15 . 5 1 O ? A HOH 2057 ? 6.03 . 6 1 O ? A HOH 2067 ? 6.43 . 7 1 O ? A HOH 2072 ? 6.26 . 8 1 O ? A HOH 2073 ? 7.18 . 9 1 O ? A HOH 2086 ? 6.60 . 10 1 O ? A HOH 2182 ? 6.68 . # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'CHLORIDE ION' CL 4 water HOH #