data_2W9R # _entry.id 2W9R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2W9R PDBE EBI-38668 WWPDB D_1290038668 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1LZW unspecified 'STRUCTURAL BASIS OF CLPS-MEDIATED SWITCH IN CLPA SUBSTRATERECOGNITION' PDB 1MBU unspecified 'CRYSTAL STRUCTURE ANALYSIS OF CLPSN HETERODIMER' PDB 1JRE unspecified 'DNA PROTECTION AND BINDING BY E. COLI DPS PROTEIN' PDB 1L8H unspecified 'DNA PROTECTION AND BINDING BY E. COLI DPS PROTEIN' PDB 1MG9 unspecified 'THE STRUCTURAL BASIS OF CLPS-MEDIATED SWITCH IN CLPASUBSTRATE RECOGNITION' PDB 1MBV unspecified 'CRYSTAL STRUCTURE ANALYSIS OF CLPSN HETERODIMER TETRAGONALFORM' PDB 1L8I unspecified 'DNA PROTECTION AND BINDING BY E. COLI DPS PROTEIN' PDB 1R6O unspecified 'ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT CLPA/ATP-DEPENDENT CLP PROTEASE ADAPTOR PROTEIN CLPS' PDB 1JTS unspecified 'DNA PROTECTION AND BINDING BY E. COLI DPS PROTEIN' PDB 1F33 unspecified 'THE STRUCTURAL BASIS FOR DNA PROTECTION BY E. COLI DPSPROTEIN' PDB 1F30 unspecified 'THE STRUCTURAL BASIS FOR DNA PROTECTION BY E. COLI DPSPROTEIN' PDB 1R6Q unspecified 'CLPNS WITH FRAGMENTS' PDB 1MBX unspecified 'CRYSTAL STRUCTURE ANALYSIS OF CLPSN WITH TRANSITION METALION BOUND' PDB 1DPS unspecified 'THE CRYSTAL STRUCTURE OF DPS, A FERRITIN HOMOLOG THAT BINDS AND PROTECTS DEOXYRIBONUCLEIC ACID' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2W9R _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2009-01-28 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schuenemann, V.' 1 'Kralik, S.M.' 2 'Albrecht, R.' 3 'Spall, S.K.' 4 'Truscott, K.N.' 5 'Dougan, D.A.' 6 'Zeth, K.' 7 # _citation.id primary _citation.title 'Structural Basis of N-End Rule Substrate Recognition in Escherichia Coli by the Clpap Adaptor Protein Clps.' _citation.journal_abbrev 'Embo Rep.' _citation.journal_volume 10 _citation.page_first 508 _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1469-221X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19373253 _citation.pdbx_database_id_DOI 10.1038/EMBOR.2009.62 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Schuenemann, V.J.' 1 primary 'Kralik, S.M.' 2 primary 'Albrecht, R.' 3 primary 'Spall, S.K.' 4 primary 'Truscott, K.N.' 5 primary 'Dougan, D.A.' 6 primary 'Zeth, K.' 7 # _cell.entry_id 2W9R _cell.length_a 28.080 _cell.length_b 28.230 _cell.length_c 38.910 _cell.angle_alpha 97.44 _cell.angle_beta 106.45 _cell.angle_gamma 92.39 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2W9R _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS' 12321.168 1 ? ? ? 'CLPS PROTEIN FROM ESCHERICHIA COLI IN COMPLEX WITH LEU-PEPTIDE' 2 polymer man 'DNA PROTECTION DURING STARVATION PROTEIN' 1251.515 1 ? ? 'RESIDUES 10-16' ? 3 water nat water 18.015 68 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 YLJA 2 'PEXB, VTM' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEV AETKVAMVNKYARENEHPLLCTLEKAGA ; ;MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEV AETKVAMVNKYARENEHPLLCTLEKAGA ; A ? 2 'polypeptide(L)' no no LVKSKATNLLY LVKSKATNLLY B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LYS n 1 4 THR n 1 5 ASN n 1 6 ASP n 1 7 TRP n 1 8 LEU n 1 9 ASP n 1 10 PHE n 1 11 ASP n 1 12 GLN n 1 13 LEU n 1 14 ALA n 1 15 GLU n 1 16 GLU n 1 17 LYS n 1 18 VAL n 1 19 ARG n 1 20 ASP n 1 21 ALA n 1 22 LEU n 1 23 LYS n 1 24 PRO n 1 25 PRO n 1 26 SER n 1 27 MET n 1 28 TYR n 1 29 LYS n 1 30 VAL n 1 31 ILE n 1 32 LEU n 1 33 VAL n 1 34 ASN n 1 35 ASP n 1 36 ASP n 1 37 TYR n 1 38 THR n 1 39 PRO n 1 40 MET n 1 41 GLU n 1 42 PHE n 1 43 VAL n 1 44 ILE n 1 45 ASP n 1 46 VAL n 1 47 LEU n 1 48 GLN n 1 49 LYS n 1 50 PHE n 1 51 PHE n 1 52 SER n 1 53 TYR n 1 54 ASP n 1 55 VAL n 1 56 GLU n 1 57 ARG n 1 58 ALA n 1 59 THR n 1 60 GLN n 1 61 LEU n 1 62 MET n 1 63 LEU n 1 64 ALA n 1 65 VAL n 1 66 HIS n 1 67 TYR n 1 68 GLN n 1 69 GLY n 1 70 LYS n 1 71 ALA n 1 72 ILE n 1 73 CYS n 1 74 GLY n 1 75 VAL n 1 76 PHE n 1 77 THR n 1 78 ALA n 1 79 GLU n 1 80 VAL n 1 81 ALA n 1 82 GLU n 1 83 THR n 1 84 LYS n 1 85 VAL n 1 86 ALA n 1 87 MET n 1 88 VAL n 1 89 ASN n 1 90 LYS n 1 91 TYR n 1 92 ALA n 1 93 ARG n 1 94 GLU n 1 95 ASN n 1 96 GLU n 1 97 HIS n 1 98 PRO n 1 99 LEU n 1 100 LEU n 1 101 CYS n 1 102 THR n 1 103 LEU n 1 104 GLU n 1 105 LYS n 1 106 ALA n 1 107 GLY n 1 108 ALA n 2 1 LEU n 2 2 VAL n 2 3 LYS n 2 4 SER n 2 5 LYS n 2 6 ALA n 2 7 THR n 2 8 ASN n 2 9 LEU n 2 10 LEU n 2 11 TYR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? ? ? ? ? K12 ? ? ? ? 'ESCHERICHIA COLI' 83333 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 511693 ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? ? PET ? ? ? ? ? 2 1 sample ? ? ? ? ? ? ? K12 ? ? ? ? 'ESCHERICHIA COLI' 83333 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 511693 ? ? ? ? ? ? BL21 ? ? ? ? ? ? ? ? PET ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP CLPS_ECOLI 1 ? ? P0A8Q6 ? 2 PDB 2W9R 1 ? ? 2W9R ? 3 UNP DPS_ECOLI 2 ? ? P0ABT2 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2W9R A 1 ? 106 ? P0A8Q6 1 ? 106 ? 1 106 2 2 2W9R A 107 ? 108 ? 2W9R 107 ? 108 ? 107 108 3 3 2W9R B 1 ? 11 ? P0ABT2 6 ? 16 ? 1 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2W9R _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.3 _exptl_crystal.density_percent_sol 48 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7' # _diffrn.id 1 _diffrn.ambient_temp 90 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_wavelength 0.97 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2W9R _reflns.observed_criterion_sigma_I 4.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.00 _reflns.d_resolution_high 1.70 _reflns.number_obs 11540 _reflns.number_all ? _reflns.percent_possible_obs 91.1 _reflns.pdbx_Rmerge_I_obs 0.04 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.40 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2W9R _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 10925 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 25.00 _refine.ls_d_res_high 1.70 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.228 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.226 _refine.ls_R_factor_R_free 0.254 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 574 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.932 _refine.correlation_coeff_Fo_to_Fc_free 0.917 _refine.B_iso_mean 22.07 _refine.aniso_B[1][1] -0.78000 _refine.aniso_B[2][2] -0.66000 _refine.aniso_B[3][3] 1.97000 _refine.aniso_B[1][2] -0.38000 _refine.aniso_B[1][3] 1.15000 _refine.aniso_B[2][3] -0.33000 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.236 _refine.pdbx_overall_ESU_R_Free 0.128 _refine.overall_SU_ML 0.094 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 6.186 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 856 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 924 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 25.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.009 0.022 ? 876 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.193 1.985 ? 1185 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.005 5.000 ? 108 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 39.382 25.135 ? 37 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.099 15.000 ? 163 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 22.223 15.000 ? 3 'X-RAY DIFFRACTION' ? r_chiral_restr 0.081 0.200 ? 140 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.020 ? 635 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.204 0.200 ? 412 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.302 0.200 ? 616 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.124 0.200 ? 50 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.228 0.200 ? 75 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.181 0.200 ? 13 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.699 1.500 ? 560 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.099 2.000 ? 876 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 1.530 3.000 ? 359 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 2.223 4.500 ? 308 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.70 _refine_ls_shell.d_res_low 1.74 _refine_ls_shell.number_reflns_R_work 798 _refine_ls_shell.R_factor_R_work 0.2780 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.3280 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 41 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2W9R _struct.title 'Structural basis of N-end rule substrate recognition in Escherichia coli by the ClpAP adaptor protein ClpS' _struct.pdbx_descriptor 'ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS, DNA PROTECTION DURING STARVATION PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2W9R _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text ;CHAPERONE, ADAPTOR PROTEIN, DNA CONDENSATION, IRON, CLPS, CLPA, CYTOPLASM, N-END RULE, DNA-BINDING, IRON STORAGE, METAL-BINDING, OXIDOREDUCTASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 12 ? ALA A 21 ? GLN A 12 ALA A 21 1 ? 10 HELX_P HELX_P2 2 PRO A 39 ? SER A 52 ? PRO A 39 SER A 52 1 ? 14 HELX_P HELX_P3 3 ASP A 54 ? GLY A 69 ? ASP A 54 GLY A 69 1 ? 16 HELX_P HELX_P4 4 ALA A 78 ? ASN A 95 ? ALA A 78 ASN A 95 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LYS A 70 ? THR A 77 ? LYS A 70 THR A 77 AA 2 MET A 27 ? VAL A 33 ? MET A 27 VAL A 33 AA 3 LEU A 100 ? LYS A 105 ? LEU A 100 LYS A 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N PHE A 76 ? N PHE A 76 O TYR A 28 ? O TYR A 28 AA 2 3 N VAL A 33 ? N VAL A 33 O LEU A 100 ? O LEU A 100 # _database_PDB_matrix.entry_id 2W9R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2W9R _atom_sites.fract_transf_matrix[1][1] 0.035613 _atom_sites.fract_transf_matrix[1][2] 0.001486 _atom_sites.fract_transf_matrix[1][3] 0.010853 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.035454 _atom_sites.fract_transf_matrix[2][3] 0.005286 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027093 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 TRP 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 ASP 9 9 ? ? ? A . n A 1 10 PHE 10 10 ? ? ? A . n A 1 11 ASP 11 11 ? ? ? A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ALA 108 108 108 ALA ALA A . n B 2 1 LEU 1 1 1 LEU LEU B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 LYS 3 3 3 LYS LYS B . n B 2 4 SER 4 4 4 SER SER B . n B 2 5 LYS 5 5 5 LYS LYS B . n B 2 6 ALA 6 6 6 ALA ALA B . n B 2 7 THR 7 7 7 THR THR B . n B 2 8 ASN 8 8 8 ASN ASN B . n B 2 9 LEU 9 9 9 LEU LEU B . n B 2 10 LEU 10 10 10 LEU LEU B . n B 2 11 TYR 11 11 11 TYR TYR B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . C 3 HOH 47 2047 2047 HOH HOH A . C 3 HOH 48 2048 2048 HOH HOH A . C 3 HOH 49 2049 2049 HOH HOH A . C 3 HOH 50 2050 2050 HOH HOH A . C 3 HOH 51 2051 2051 HOH HOH A . C 3 HOH 52 2052 2052 HOH HOH A . C 3 HOH 53 2053 2053 HOH HOH A . C 3 HOH 54 2054 2054 HOH HOH A . C 3 HOH 55 2055 2055 HOH HOH A . C 3 HOH 56 2056 2056 HOH HOH A . C 3 HOH 57 2057 2057 HOH HOH A . C 3 HOH 58 2058 2058 HOH HOH A . C 3 HOH 59 2059 2059 HOH HOH A . C 3 HOH 60 2060 2060 HOH HOH A . C 3 HOH 61 2061 2061 HOH HOH A . C 3 HOH 62 2062 2062 HOH HOH A . C 3 HOH 63 2063 2063 HOH HOH A . D 3 HOH 1 2001 2001 HOH HOH B . D 3 HOH 2 2002 2002 HOH HOH B . D 3 HOH 3 2003 2003 HOH HOH B . D 3 HOH 4 2004 2004 HOH HOH B . D 3 HOH 5 2005 2005 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 570 ? 1 MORE -5.04 ? 1 'SSA (A^2)' 7700 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-04-28 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 XDS 'data reduction' . ? 2 XDS 'data scaling' . ? 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 56 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 60 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A TRP 7 ? A TRP 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A ASP 9 ? A ASP 9 10 1 Y 1 A PHE 10 ? A PHE 10 11 1 Y 1 A ASP 11 ? A ASP 11 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #