data_2WB6 # _entry.id 2WB6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2WB6 PDBE EBI-38851 WWPDB D_1290038851 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2WB7 _pdbx_database_related.content_type unspecified _pdbx_database_related.details PT26-6P # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2WB6 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2009-02-22 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Keller, J.' 1 'Leulliot, N.' 2 'Collinet, B.' 3 'Campanacci, V.' 4 'Cambillau, C.' 5 'Pranghisvilli, D.' 6 'van Tilbeurgh, H.' 7 # _citation.id primary _citation.title 'Crystal Structure of Afv1-102, a Protein from the Acidianus Filamentous Virus 1.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 18 _citation.page_first 845 _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19319936 _citation.pdbx_database_id_DOI 10.1002/PRO.79 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Keller, J.' 1 primary 'Leulliot, N.' 2 primary 'Collinet, B.' 3 primary 'Campanacci, V.' 4 primary 'Cambillau, C.' 5 primary 'Pranghisvilli, D.' 6 primary 'Van Tilbeurgh, H.' 7 # _cell.entry_id 2WB6 _cell.length_a 62.890 _cell.length_b 62.890 _cell.length_c 110.837 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2WB6 _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man AFV1-102 15049.633 1 ? ? 'RESIDUES 2-102' ? 2 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 3 water nat water 18.015 82 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSYYHHHHHHLESTSLYKKAGSENLYFQGIVDKNKIVIPMSEFLDSMFLVIEKLGVHAEKKGSMIFLSSERVKLADWKQL GAMCSDCYHCKLPLSSFIEIVTRKAKDKFLVMYNEKEVTLVARGVQTIQK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSYYHHHHHHLESTSLYKKAGSENLYFQGIVDKNKIVIPMSEFLDSMFLVIEKLGVHAEKKGSMIFLSSERVKLADWKQL GAMCSDCYHCKLPLSSFIEIVTRKAKDKFLVMYNEKEVTLVARGVQTIQK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 TYR n 1 4 TYR n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 LEU n 1 12 GLU n 1 13 SER n 1 14 THR n 1 15 SER n 1 16 LEU n 1 17 TYR n 1 18 LYS n 1 19 LYS n 1 20 ALA n 1 21 GLY n 1 22 SER n 1 23 GLU n 1 24 ASN n 1 25 LEU n 1 26 TYR n 1 27 PHE n 1 28 GLN n 1 29 GLY n 1 30 ILE n 1 31 VAL n 1 32 ASP n 1 33 LYS n 1 34 ASN n 1 35 LYS n 1 36 ILE n 1 37 VAL n 1 38 ILE n 1 39 PRO n 1 40 MET n 1 41 SER n 1 42 GLU n 1 43 PHE n 1 44 LEU n 1 45 ASP n 1 46 SER n 1 47 MET n 1 48 PHE n 1 49 LEU n 1 50 VAL n 1 51 ILE n 1 52 GLU n 1 53 LYS n 1 54 LEU n 1 55 GLY n 1 56 VAL n 1 57 HIS n 1 58 ALA n 1 59 GLU n 1 60 LYS n 1 61 LYS n 1 62 GLY n 1 63 SER n 1 64 MET n 1 65 ILE n 1 66 PHE n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 GLU n 1 71 ARG n 1 72 VAL n 1 73 LYS n 1 74 LEU n 1 75 ALA n 1 76 ASP n 1 77 TRP n 1 78 LYS n 1 79 GLN n 1 80 LEU n 1 81 GLY n 1 82 ALA n 1 83 MET n 1 84 CYS n 1 85 SER n 1 86 ASP n 1 87 CYS n 1 88 TYR n 1 89 HIS n 1 90 CYS n 1 91 LYS n 1 92 LEU n 1 93 PRO n 1 94 LEU n 1 95 SER n 1 96 SER n 1 97 PHE n 1 98 ILE n 1 99 GLU n 1 100 ILE n 1 101 VAL n 1 102 THR n 1 103 ARG n 1 104 LYS n 1 105 ALA n 1 106 LYS n 1 107 ASP n 1 108 LYS n 1 109 PHE n 1 110 LEU n 1 111 VAL n 1 112 MET n 1 113 TYR n 1 114 ASN n 1 115 GLU n 1 116 LYS n 1 117 GLU n 1 118 VAL n 1 119 THR n 1 120 LEU n 1 121 VAL n 1 122 ALA n 1 123 ARG n 1 124 GLY n 1 125 VAL n 1 126 GLN n 1 127 THR n 1 128 ILE n 1 129 GLN n 1 130 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ACIDIANUS FILAMENTOUS VIRUS 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 235266 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name GATEWAY _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2WB6 1 ? ? 2WB6 ? 2 UNP Q70LC3_9VIRU 1 ? ? Q70LC3 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2WB6 A 1 ? 29 ? 2WB6 -29 ? -1 ? -29 -1 2 2 2WB6 A 30 ? 130 ? Q70LC3 2 ? 102 ? 2 102 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2WB6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_percent_sol 49 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.5-2M AMMONIUM SULFATE, 0.1M HEPES PH 7.5, 2% PEG400' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength 0.97 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2WB6 _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 54.47 _reflns.d_resolution_high 1.95 _reflns.number_obs 10006 _reflns.number_all ? _reflns.percent_possible_obs 99.5 _reflns.pdbx_Rmerge_I_obs 0.11 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 4.40 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 34.7 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.00 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.59 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 0.80 _reflns_shell.pdbx_redundancy 38 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2WB6 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 9472 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 54.47 _refine.ls_d_res_high 1.95 _refine.ls_percent_reflns_obs 99.24 _refine.ls_R_factor_obs 0.21619 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.21339 _refine.ls_R_factor_R_free 0.27431 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 481 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.909 _refine.B_iso_mean 38.031 _refine.aniso_B[1][1] -0.60 _refine.aniso_B[2][2] -0.60 _refine.aniso_B[3][3] 0.90 _refine.aniso_B[1][2] -0.30 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.611 _refine.pdbx_overall_ESU_R_Free 0.177 _refine.overall_SU_ML 0.121 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 9.236 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 906 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 82 _refine_hist.number_atoms_total 990 _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 54.47 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.011 0.022 ? 930 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.313 1.987 ? 1245 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.982 5.000 ? 114 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 26.554 24.571 ? 35 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.617 15.000 ? 191 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 7.775 15.000 ? 3 'X-RAY DIFFRACTION' ? r_chiral_restr 0.088 0.200 ? 142 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 651 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.279 1.500 ? 570 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.473 2.000 ? 918 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 10.810 3.000 ? 360 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 8.131 4.500 ? 327 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 12.305 3.000 ? 930 'X-RAY DIFFRACTION' ? r_sphericity_free 3.987 3.000 ? 85 'X-RAY DIFFRACTION' ? r_sphericity_bonded 5.484 3.000 ? 914 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.950 _refine_ls_shell.d_res_low 2.001 _refine_ls_shell.number_reflns_R_work 675 _refine_ls_shell.R_factor_R_work 0.241 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.224 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 38 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2WB6 _struct.title 'Crystal structure of AFV1-102, a protein from the Acidianus Filamentous Virus 1' _struct.pdbx_descriptor AFV1-102 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2WB6 _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'ARCHAEAL VIRUS, VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 12 ? LYS A 18 ? GLU A -18 LYS A -12 5 ? 7 HELX_P HELX_P2 2 SER A 22 ? GLY A 29 ? SER A -8 GLY A -1 1 ? 8 HELX_P HELX_P3 3 MET A 40 ? LYS A 53 ? MET A 12 LYS A 25 1 ? 14 HELX_P HELX_P4 4 LEU A 74 ? LEU A 80 ? LEU A 46 LEU A 52 1 ? 7 HELX_P HELX_P5 5 LEU A 94 ? THR A 102 ? LEU A 66 THR A 74 1 ? 9 HELX_P HELX_P6 6 ARG A 103 ? ASP A 107 ? ARG A 75 ASP A 79 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 84 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 90 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 56 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 62 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.047 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 4 ? AB ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ILE A 30 ? VAL A 31 ? ILE A 2 VAL A 3 AA 2 LYS A 35 ? PRO A 39 ? LYS A 7 PRO A 11 AA 3 GLU A 117 ? ALA A 122 ? GLU A 89 ALA A 94 AA 4 PHE A 109 ? TYR A 113 ? PHE A 81 TYR A 85 AB 1 VAL A 56 ? LYS A 61 ? VAL A 28 LYS A 33 AB 2 MET A 64 ? SER A 69 ? MET A 36 SER A 41 AB 3 HIS A 89 ? PRO A 93 ? HIS A 61 PRO A 65 AB 4 MET A 83 ? ASP A 86 ? MET A 55 ASP A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 30 ? N ILE A 2 O VAL A 37 ? O VAL A 9 AA 2 3 N ILE A 38 ? N ILE A 10 O VAL A 118 ? O VAL A 90 AA 3 4 N VAL A 121 ? N VAL A 93 O LEU A 110 ? O LEU A 82 AB 1 2 N LYS A 61 ? N LYS A 33 O MET A 64 ? O MET A 36 AB 2 3 N LEU A 67 ? N LEU A 39 O CYS A 90 ? O CYS A 62 AB 3 4 N LYS A 91 ? N LYS A 63 O MET A 83 ? O MET A 55 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 1001' AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 1002' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 GLY A 62 ? GLY A 34 . ? 1_555 ? 2 AC2 1 ARG A 103 ? ARG A 75 . ? 7_555 ? # _database_PDB_matrix.entry_id 2WB6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2WB6 _atom_sites.fract_transf_matrix[1][1] 0.015901 _atom_sites.fract_transf_matrix[1][2] 0.009180 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018361 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009022 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -29 ? ? ? A . n A 1 2 SER 2 -28 ? ? ? A . n A 1 3 TYR 3 -27 ? ? ? A . n A 1 4 TYR 4 -26 ? ? ? A . n A 1 5 HIS 5 -25 ? ? ? A . n A 1 6 HIS 6 -24 ? ? ? A . n A 1 7 HIS 7 -23 ? ? ? A . n A 1 8 HIS 8 -22 ? ? ? A . n A 1 9 HIS 9 -21 ? ? ? A . n A 1 10 HIS 10 -20 ? ? ? A . n A 1 11 LEU 11 -19 -19 LEU LEU A . n A 1 12 GLU 12 -18 -18 GLU GLU A . n A 1 13 SER 13 -17 -17 SER SER A . n A 1 14 THR 14 -16 -16 THR THR A . n A 1 15 SER 15 -15 -15 SER SER A . n A 1 16 LEU 16 -14 -14 LEU LEU A . n A 1 17 TYR 17 -13 -13 TYR TYR A . n A 1 18 LYS 18 -12 -12 LYS LYS A . n A 1 19 LYS 19 -11 -11 LYS LYS A . n A 1 20 ALA 20 -10 -10 ALA ALA A . n A 1 21 GLY 21 -9 -9 GLY GLY A . n A 1 22 SER 22 -8 -8 SER SER A . n A 1 23 GLU 23 -7 -7 GLU GLU A . n A 1 24 ASN 24 -6 -6 ASN ASN A . n A 1 25 LEU 25 -5 -5 LEU LEU A . n A 1 26 TYR 26 -4 -4 TYR TYR A . n A 1 27 PHE 27 -3 -3 PHE PHE A . n A 1 28 GLN 28 -2 -2 GLN GLN A . n A 1 29 GLY 29 -1 -1 GLY GLY A . n A 1 30 ILE 30 2 2 ILE ILE A . n A 1 31 VAL 31 3 3 VAL VAL A . n A 1 32 ASP 32 4 4 ASP ASP A . n A 1 33 LYS 33 5 5 LYS LYS A . n A 1 34 ASN 34 6 6 ASN ASN A . n A 1 35 LYS 35 7 7 LYS LYS A . n A 1 36 ILE 36 8 8 ILE ILE A . n A 1 37 VAL 37 9 9 VAL VAL A . n A 1 38 ILE 38 10 10 ILE ILE A . n A 1 39 PRO 39 11 11 PRO PRO A . n A 1 40 MET 40 12 12 MET MET A . n A 1 41 SER 41 13 13 SER SER A . n A 1 42 GLU 42 14 14 GLU GLU A . n A 1 43 PHE 43 15 15 PHE PHE A . n A 1 44 LEU 44 16 16 LEU LEU A . n A 1 45 ASP 45 17 17 ASP ASP A . n A 1 46 SER 46 18 18 SER SER A . n A 1 47 MET 47 19 19 MET MET A . n A 1 48 PHE 48 20 20 PHE PHE A . n A 1 49 LEU 49 21 21 LEU LEU A . n A 1 50 VAL 50 22 22 VAL VAL A . n A 1 51 ILE 51 23 23 ILE ILE A . n A 1 52 GLU 52 24 24 GLU GLU A . n A 1 53 LYS 53 25 25 LYS LYS A . n A 1 54 LEU 54 26 26 LEU LEU A . n A 1 55 GLY 55 27 27 GLY GLY A . n A 1 56 VAL 56 28 28 VAL VAL A . n A 1 57 HIS 57 29 29 HIS HIS A . n A 1 58 ALA 58 30 30 ALA ALA A . n A 1 59 GLU 59 31 31 GLU GLU A . n A 1 60 LYS 60 32 32 LYS LYS A . n A 1 61 LYS 61 33 33 LYS LYS A . n A 1 62 GLY 62 34 34 GLY GLY A . n A 1 63 SER 63 35 35 SER SER A . n A 1 64 MET 64 36 36 MET MET A . n A 1 65 ILE 65 37 37 ILE ILE A . n A 1 66 PHE 66 38 38 PHE PHE A . n A 1 67 LEU 67 39 39 LEU LEU A . n A 1 68 SER 68 40 40 SER SER A . n A 1 69 SER 69 41 41 SER SER A . n A 1 70 GLU 70 42 42 GLU GLU A . n A 1 71 ARG 71 43 43 ARG ARG A . n A 1 72 VAL 72 44 44 VAL VAL A . n A 1 73 LYS 73 45 45 LYS LYS A . n A 1 74 LEU 74 46 46 LEU LEU A . n A 1 75 ALA 75 47 47 ALA ALA A . n A 1 76 ASP 76 48 48 ASP ASP A . n A 1 77 TRP 77 49 49 TRP TRP A . n A 1 78 LYS 78 50 50 LYS LYS A . n A 1 79 GLN 79 51 51 GLN GLN A . n A 1 80 LEU 80 52 52 LEU LEU A . n A 1 81 GLY 81 53 53 GLY GLY A . n A 1 82 ALA 82 54 54 ALA ALA A . n A 1 83 MET 83 55 55 MET MET A . n A 1 84 CYS 84 56 56 CYS CYS A . n A 1 85 SER 85 57 57 SER SER A . n A 1 86 ASP 86 58 58 ASP ASP A . n A 1 87 CYS 87 59 59 CYS CYS A . n A 1 88 TYR 88 60 60 TYR TYR A . n A 1 89 HIS 89 61 61 HIS HIS A . n A 1 90 CYS 90 62 62 CYS CYS A . n A 1 91 LYS 91 63 63 LYS LYS A . n A 1 92 LEU 92 64 64 LEU LEU A . n A 1 93 PRO 93 65 65 PRO PRO A . n A 1 94 LEU 94 66 66 LEU LEU A . n A 1 95 SER 95 67 67 SER SER A . n A 1 96 SER 96 68 68 SER SER A . n A 1 97 PHE 97 69 69 PHE PHE A . n A 1 98 ILE 98 70 70 ILE ILE A . n A 1 99 GLU 99 71 71 GLU GLU A . n A 1 100 ILE 100 72 72 ILE ILE A . n A 1 101 VAL 101 73 73 VAL VAL A . n A 1 102 THR 102 74 74 THR THR A . n A 1 103 ARG 103 75 75 ARG ARG A . n A 1 104 LYS 104 76 76 LYS LYS A . n A 1 105 ALA 105 77 77 ALA ALA A . n A 1 106 LYS 106 78 78 LYS LYS A . n A 1 107 ASP 107 79 79 ASP ASP A . n A 1 108 LYS 108 80 80 LYS LYS A . n A 1 109 PHE 109 81 81 PHE PHE A . n A 1 110 LEU 110 82 82 LEU LEU A . n A 1 111 VAL 111 83 83 VAL VAL A . n A 1 112 MET 112 84 84 MET MET A . n A 1 113 TYR 113 85 85 TYR TYR A . n A 1 114 ASN 114 86 86 ASN ASN A . n A 1 115 GLU 115 87 87 GLU GLU A . n A 1 116 LYS 116 88 88 LYS LYS A . n A 1 117 GLU 117 89 89 GLU GLU A . n A 1 118 VAL 118 90 90 VAL VAL A . n A 1 119 THR 119 91 91 THR THR A . n A 1 120 LEU 120 92 92 LEU LEU A . n A 1 121 VAL 121 93 93 VAL VAL A . n A 1 122 ALA 122 94 94 ALA ALA A . n A 1 123 ARG 123 95 95 ARG ARG A . n A 1 124 GLY 124 96 96 GLY GLY A . n A 1 125 VAL 125 97 ? ? ? A . n A 1 126 GLN 126 98 ? ? ? A . n A 1 127 THR 127 99 ? ? ? A . n A 1 128 ILE 128 100 ? ? ? A . n A 1 129 GLN 129 101 ? ? ? A . n A 1 130 LYS 130 102 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 1001 1001 CL CL A . C 2 CL 1 1002 1002 CL CL A . D 3 HOH 1 2001 2001 HOH HOH A . D 3 HOH 2 2002 2002 HOH HOH A . D 3 HOH 3 2003 2003 HOH HOH A . D 3 HOH 4 2004 2004 HOH HOH A . D 3 HOH 5 2005 2005 HOH HOH A . D 3 HOH 6 2006 2006 HOH HOH A . D 3 HOH 7 2007 2007 HOH HOH A . D 3 HOH 8 2008 2008 HOH HOH A . D 3 HOH 9 2009 2009 HOH HOH A . D 3 HOH 10 2010 2010 HOH HOH A . D 3 HOH 11 2011 2011 HOH HOH A . D 3 HOH 12 2012 2012 HOH HOH A . D 3 HOH 13 2013 2013 HOH HOH A . D 3 HOH 14 2014 2014 HOH HOH A . D 3 HOH 15 2015 2015 HOH HOH A . D 3 HOH 16 2016 2016 HOH HOH A . D 3 HOH 17 2017 2017 HOH HOH A . D 3 HOH 18 2018 2018 HOH HOH A . D 3 HOH 19 2019 2019 HOH HOH A . D 3 HOH 20 2020 2020 HOH HOH A . D 3 HOH 21 2021 2021 HOH HOH A . D 3 HOH 22 2022 2022 HOH HOH A . D 3 HOH 23 2023 2023 HOH HOH A . D 3 HOH 24 2024 2024 HOH HOH A . D 3 HOH 25 2025 2025 HOH HOH A . D 3 HOH 26 2026 2026 HOH HOH A . D 3 HOH 27 2027 2027 HOH HOH A . D 3 HOH 28 2028 2028 HOH HOH A . D 3 HOH 29 2029 2029 HOH HOH A . D 3 HOH 30 2030 2030 HOH HOH A . D 3 HOH 31 2031 2031 HOH HOH A . D 3 HOH 32 2032 2032 HOH HOH A . D 3 HOH 33 2033 2033 HOH HOH A . D 3 HOH 34 2034 2034 HOH HOH A . D 3 HOH 35 2035 2035 HOH HOH A . D 3 HOH 36 2036 2036 HOH HOH A . D 3 HOH 37 2037 2037 HOH HOH A . D 3 HOH 38 2038 2038 HOH HOH A . D 3 HOH 39 2039 2039 HOH HOH A . D 3 HOH 40 2040 2040 HOH HOH A . D 3 HOH 41 2041 2041 HOH HOH A . D 3 HOH 42 2042 2042 HOH HOH A . D 3 HOH 43 2043 2043 HOH HOH A . D 3 HOH 44 2044 2044 HOH HOH A . D 3 HOH 45 2045 2045 HOH HOH A . D 3 HOH 46 2046 2046 HOH HOH A . D 3 HOH 47 2047 2047 HOH HOH A . D 3 HOH 48 2048 2048 HOH HOH A . D 3 HOH 49 2049 2049 HOH HOH A . D 3 HOH 50 2050 2050 HOH HOH A . D 3 HOH 51 2051 2051 HOH HOH A . D 3 HOH 52 2052 2052 HOH HOH A . D 3 HOH 53 2053 2053 HOH HOH A . D 3 HOH 54 2054 2054 HOH HOH A . D 3 HOH 55 2055 2055 HOH HOH A . D 3 HOH 56 2056 2056 HOH HOH A . D 3 HOH 57 2057 2057 HOH HOH A . D 3 HOH 58 2058 2058 HOH HOH A . D 3 HOH 59 2059 2059 HOH HOH A . D 3 HOH 60 2060 2060 HOH HOH A . D 3 HOH 61 2061 2061 HOH HOH A . D 3 HOH 62 2062 2062 HOH HOH A . D 3 HOH 63 2063 2063 HOH HOH A . D 3 HOH 64 2064 2064 HOH HOH A . D 3 HOH 65 2065 2065 HOH HOH A . D 3 HOH 66 2066 2066 HOH HOH A . D 3 HOH 67 2067 2067 HOH HOH A . D 3 HOH 68 2068 2068 HOH HOH A . D 3 HOH 69 2069 2069 HOH HOH A . D 3 HOH 70 2070 2070 HOH HOH A . D 3 HOH 71 2071 2071 HOH HOH A . D 3 HOH 72 2072 2072 HOH HOH A . D 3 HOH 73 2073 2073 HOH HOH A . D 3 HOH 74 2074 2074 HOH HOH A . D 3 HOH 75 2075 2075 HOH HOH A . D 3 HOH 76 2076 2076 HOH HOH A . D 3 HOH 77 2077 2077 HOH HOH A . D 3 HOH 78 2078 2078 HOH HOH A . D 3 HOH 79 2079 2079 HOH HOH A . D 3 HOH 80 2080 2080 HOH HOH A . D 3 HOH 81 2081 2081 HOH HOH A . D 3 HOH 82 2082 2082 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1230 ? 1 MORE -10.4 ? 1 'SSA (A^2)' 15410 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/6 0.5000000000 0.8660254038 0.0000000000 -31.4450000000 0.8660254038 -0.5000000000 0.0000000000 54.4643376440 0.0000000000 0.0000000000 -1.0000000000 18.4728333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-03-03 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.4.0077 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 SOLVE phasing . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2018 ? ? O A HOH 2021 ? ? 1.75 2 1 O A HOH 2016 ? ? O A HOH 2018 ? ? 1.78 3 1 O A HOH 2004 ? ? O A HOH 2016 ? ? 1.98 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 2051 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 2071 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 12_565 _pdbx_validate_symm_contact.dist 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 43 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -107.28 _pdbx_validate_torsion.psi -71.88 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -29 ? A MET 1 2 1 Y 1 A SER -28 ? A SER 2 3 1 Y 1 A TYR -27 ? A TYR 3 4 1 Y 1 A TYR -26 ? A TYR 4 5 1 Y 1 A HIS -25 ? A HIS 5 6 1 Y 1 A HIS -24 ? A HIS 6 7 1 Y 1 A HIS -23 ? A HIS 7 8 1 Y 1 A HIS -22 ? A HIS 8 9 1 Y 1 A HIS -21 ? A HIS 9 10 1 Y 1 A HIS -20 ? A HIS 10 11 1 Y 1 A VAL 97 ? A VAL 125 12 1 Y 1 A GLN 98 ? A GLN 126 13 1 Y 1 A THR 99 ? A THR 127 14 1 Y 1 A ILE 100 ? A ILE 128 15 1 Y 1 A GLN 101 ? A GLN 129 16 1 Y 1 A LYS 102 ? A LYS 130 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH #