data_2XMW # _entry.id 2XMW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2XMW PDBE EBI-44870 WWPDB D_1290044870 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2GCF unspecified 'SOLUTION STRUCTURE OF THE N-TERMINAL DOMAIN OF THECOPPPER(I) ATPASE PACS IN ITS APO FORM' PDB 2XMT unspecified 'COPPER CHAPERONE ATX1 FROM SYNECHOCYSTIS PCC6803 (CU1 FORM)' PDB 2XMV unspecified 'COPPER CHAPERONE ATX1 FROM SYNECHOCYSTIS PCC6803 (CU1, TRIMERIC FORM, HIS61TYR MUTANT)' PDB 2XMM unspecified 'VISUALISING THE METAL-BINDING VERSATILITY OF COPPER TRAFFICKING SITES: H61Y ATX1 SIDE-TO-SIDE' PDB 2XMK unspecified 'VISUALISING THE METAL-BINDING VERSATILITY OF COPPER TRAFFICKING SITES: ATX1 SIDE-TO-SIDE (ANAEROBIC)' PDB 2XMJ unspecified 'VISUALISING THE METAL-BINDING VERSATILITY OF COPPER TRAFFICKING SITES: ATX1 SIDE-TO-SIDE (AEROBIC)' PDB 2XMU unspecified 'COPPER CHAPERONE ATX1 FROM SYNECHOCYSTIS PCC6803 (CU2 FORM)' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2XMW _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-07-29 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Badarau, A.' 1 'Firbank, S.J.' 2 'McCarthy, A.A.' 3 'Banfield, M.J.' 4 'Dennison, C.' 5 # _citation.id primary _citation.title 'Visualizing the Metal-Binding Versatility of Copper Trafficking Sites .' _citation.journal_abbrev Biochemistry _citation.journal_volume 49 _citation.page_first 7798 _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20726513 _citation.pdbx_database_id_DOI 10.1021/BI101064W # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Badarau, A.' 1 primary 'Firbank, S.J.' 2 primary 'Mccarthy, A.A.' 3 primary 'Banfield, M.J.' 4 primary 'Dennison, C.' 5 # _cell.entry_id 2XMW _cell.length_a 45.580 _cell.length_b 45.580 _cell.length_c 51.831 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2XMW _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CATION-TRANSPORTING ATPASE PACS' 7653.774 1 ? ? 'N-TERMINAL, COPPER-BINDING DOMAIN, RESIDUES 1-71' ? 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? 3 water nat water 18.015 12 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PACS-N # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MAQTINLQLEGMRCAACASSIERAIAKVPGVQSCQVNFALEQAVVSYHGETTPQILTDAVERAGYHARVLK _entity_poly.pdbx_seq_one_letter_code_can MAQTINLQLEGMRCAACASSIERAIAKVPGVQSCQVNFALEQAVVSYHGETTPQILTDAVERAGYHARVLK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLN n 1 4 THR n 1 5 ILE n 1 6 ASN n 1 7 LEU n 1 8 GLN n 1 9 LEU n 1 10 GLU n 1 11 GLY n 1 12 MET n 1 13 ARG n 1 14 CYS n 1 15 ALA n 1 16 ALA n 1 17 CYS n 1 18 ALA n 1 19 SER n 1 20 SER n 1 21 ILE n 1 22 GLU n 1 23 ARG n 1 24 ALA n 1 25 ILE n 1 26 ALA n 1 27 LYS n 1 28 VAL n 1 29 PRO n 1 30 GLY n 1 31 VAL n 1 32 GLN n 1 33 SER n 1 34 CYS n 1 35 GLN n 1 36 VAL n 1 37 ASN n 1 38 PHE n 1 39 ALA n 1 40 LEU n 1 41 GLU n 1 42 GLN n 1 43 ALA n 1 44 VAL n 1 45 VAL n 1 46 SER n 1 47 TYR n 1 48 HIS n 1 49 GLY n 1 50 GLU n 1 51 THR n 1 52 THR n 1 53 PRO n 1 54 GLN n 1 55 ILE n 1 56 LEU n 1 57 THR n 1 58 ASP n 1 59 ALA n 1 60 VAL n 1 61 GLU n 1 62 ARG n 1 63 ALA n 1 64 GLY n 1 65 TYR n 1 66 HIS n 1 67 ALA n 1 68 ARG n 1 69 VAL n 1 70 LEU n 1 71 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'SYNECHOCYSTIS SP. PCC 6803' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1148 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET29A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATCS_SYNY3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P73241 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2XMW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P73241 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 71 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2XMW _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_percent_sol 39.43 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '40 % (W/V) PEG 300 AND 100 MM CITRATE -PHOSPHATE PH 4.6' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2009-09-15 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.37 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_wavelength 1.37 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2XMW _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 39.47 _reflns.d_resolution_high 1.80 _reflns.number_obs 6085 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 39.00 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 23.5 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.90 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.42 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 10.30 _reflns_shell.pdbx_redundancy 23.9 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2XMW _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 5475 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 51.85 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 99.47 _refine.ls_R_factor_obs 0.24496 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.24332 _refine.ls_R_factor_R_free 0.25922 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.7 _refine.ls_number_reflns_R_free 586 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.927 _refine.correlation_coeff_Fo_to_Fc_free 0.930 _refine.B_iso_mean 23.632 _refine.aniso_B[1][1] 0.65 _refine.aniso_B[2][2] 0.65 _refine.aniso_B[3][3] -0.97 _refine.aniso_B[1][2] 0.32 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.172 _refine.pdbx_overall_ESU_R_Free 0.146 _refine.overall_SU_ML 0.069 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 2.233 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 480 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 12 _refine_hist.number_atoms_total 493 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 51.85 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.021 ? 493 'X-RAY DIFFRACTION' ? r_bond_other_d 0.003 0.020 ? 298 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.553 1.944 ? 675 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.896 3.000 ? 740 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.560 5.000 ? 69 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 43.871 25.556 ? 18 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.170 15.000 ? 72 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 1.435 15.000 ? 1 'X-RAY DIFFRACTION' ? r_chiral_restr 0.099 0.200 ? 84 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 565 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 88 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.130 1.500 ? 339 'X-RAY DIFFRACTION' ? r_mcbond_other 0.250 1.500 ? 136 'X-RAY DIFFRACTION' ? r_mcangle_it 2.006 2.000 ? 538 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.891 3.000 ? 154 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 4.646 4.500 ? 135 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.800 _refine_ls_shell.d_res_low 1.847 _refine_ls_shell.number_reflns_R_work 386 _refine_ls_shell.R_factor_R_work 0.237 _refine_ls_shell.percent_reflns_obs 99.08 _refine_ls_shell.R_factor_R_free 0.288 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 46 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2XMW _struct.title 'PacS, N-terminal domain, from Synechocystis PCC6803' _struct.pdbx_descriptor 'CATION-TRANSPORTING ATPASE PACS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2XMW _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'HYDROLASE, CU(I)-BINDING, TRAFFICKING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 14 ? LYS A 27 ? CYS A 14 LYS A 27 1 ? 14 HELX_P HELX_P2 2 THR A 52 ? GLY A 64 ? THR A 52 GLY A 64 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CU1 . CU ? ? ? 1_555 A CYS 14 SG ? ? A CU1 101 A CYS 14 1_555 ? ? ? ? ? ? ? 2.166 ? metalc2 metalc ? ? B CU1 . CU ? ? ? 1_555 A CYS 14 SG ? ? A CU1 101 A CYS 14 3_655 ? ? ? ? ? ? ? 2.387 ? metalc3 metalc ? ? B CU1 . CU ? ? ? 1_555 A CYS 17 SG ? ? A CU1 101 A CYS 17 1_555 ? ? ? ? ? ? ? 2.161 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 31 ? ASN A 37 ? VAL A 31 ASN A 37 AA 2 GLN A 42 ? TYR A 47 ? GLN A 42 TYR A 47 AA 3 GLN A 3 ? GLU A 10 ? GLN A 3 GLU A 10 AA 4 HIS A 66 ? LEU A 70 ? HIS A 66 LEU A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ASN A 37 ? N ASN A 37 O GLN A 42 ? O GLN A 42 AA 2 3 N TYR A 47 ? N TYR A 47 O GLN A 3 ? O GLN A 3 AA 3 4 N GLU A 10 ? N GLU A 10 O HIS A 66 ? O HIS A 66 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE CU1 A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 CYS A 14 ? CYS A 14 . ? 1_555 ? 2 AC1 3 CYS A 14 ? CYS A 14 . ? 3_655 ? 3 AC1 3 CYS A 17 ? CYS A 17 . ? 1_555 ? # _database_PDB_matrix.entry_id 2XMW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2XMW _atom_sites.fract_transf_matrix[1][1] 0.021939 _atom_sites.fract_transf_matrix[1][2] 0.012667 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025333 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019293 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLY 49 49 ? ? ? A . n A 1 50 GLU 50 50 ? ? ? A . n A 1 51 THR 51 51 ? ? ? A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LYS 71 71 71 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU1 1 101 101 CU1 CU1 A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 14 ? 1_555 CU ? B CU1 . ? A CU1 101 ? 1_555 SG ? A CYS 14 ? A CYS 14 ? 3_655 117.0 ? 2 SG ? A CYS 14 ? A CYS 14 ? 1_555 CU ? B CU1 . ? A CU1 101 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 141.0 ? 3 SG ? A CYS 14 ? A CYS 14 ? 3_655 CU ? B CU1 . ? A CU1 101 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 101.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-18 2 'Structure model' 1 1 2011-05-12 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.5.0035 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 PHENIX.HYSS phasing . ? 4 MLPHARE phasing . ? 5 DM phasing . ? 6 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ARG 23 ? CD ? A ARG 23 CD 2 1 Y 0 A ARG 23 ? NE ? A ARG 23 NE 3 1 Y 0 A ARG 23 ? CZ ? A ARG 23 CZ 4 1 Y 0 A ARG 23 ? NH1 ? A ARG 23 NH1 5 1 Y 0 A ARG 23 ? NH2 ? A ARG 23 NH2 6 1 Y 1 A LYS 27 ? CG ? A LYS 27 CG 7 1 Y 1 A LYS 27 ? CD ? A LYS 27 CD 8 1 Y 1 A LYS 27 ? CE ? A LYS 27 CE 9 1 Y 1 A LYS 27 ? NZ ? A LYS 27 NZ 10 1 Y 1 A GLN 32 ? CG ? A GLN 32 CG 11 1 Y 1 A GLN 32 ? CD ? A GLN 32 CD 12 1 Y 1 A GLN 32 ? OE1 ? A GLN 32 OE1 13 1 Y 1 A GLN 32 ? NE2 ? A GLN 32 NE2 14 1 Y 1 A GLN 54 ? CG ? A GLN 54 CG 15 1 Y 1 A GLN 54 ? CD ? A GLN 54 CD 16 1 Y 1 A GLN 54 ? OE1 ? A GLN 54 OE1 17 1 Y 1 A GLN 54 ? NE2 ? A GLN 54 NE2 18 1 Y 1 A ILE 55 ? CG1 ? A ILE 55 CG1 19 1 Y 1 A ILE 55 ? CG2 ? A ILE 55 CG2 20 1 Y 1 A ILE 55 ? CD1 ? A ILE 55 CD1 21 1 Y 1 A ARG 62 ? CG ? A ARG 62 CG 22 1 Y 1 A ARG 62 ? CD ? A ARG 62 CD 23 1 Y 1 A ARG 62 ? NE ? A ARG 62 NE 24 1 Y 1 A ARG 62 ? CZ ? A ARG 62 CZ 25 1 Y 1 A ARG 62 ? NH1 ? A ARG 62 NH1 26 1 Y 1 A ARG 62 ? NH2 ? A ARG 62 NH2 27 1 Y 1 A ARG 68 ? NE ? A ARG 68 NE 28 1 Y 1 A ARG 68 ? CZ ? A ARG 68 CZ 29 1 Y 1 A ARG 68 ? NH1 ? A ARG 68 NH1 30 1 Y 1 A ARG 68 ? NH2 ? A ARG 68 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 49 ? A GLY 49 3 1 Y 1 A GLU 50 ? A GLU 50 4 1 Y 1 A THR 51 ? A THR 51 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (I) ION' CU1 3 water HOH #