data_2YRG # _entry.id 2YRG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YRG pdb_00002yrg 10.2210/pdb2yrg/pdb RCSB RCSB027040 ? ? WWPDB D_1000027040 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsb001014687.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2YRG _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-04-02 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Hayahsi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the B-box domain from tripartite motif-containing protein 5' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tripartite motif-containing protein 5' 6346.976 1 6.3.2.- ? 'B-box domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RING finger protein 88' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFPTSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFPTSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsb001014687.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 PRO n 1 10 GLU n 1 11 GLY n 1 12 GLN n 1 13 LYS n 1 14 VAL n 1 15 ASP n 1 16 HIS n 1 17 CYS n 1 18 ALA n 1 19 ARG n 1 20 HIS n 1 21 GLY n 1 22 GLU n 1 23 LYS n 1 24 LEU n 1 25 LEU n 1 26 LEU n 1 27 PHE n 1 28 CYS n 1 29 GLN n 1 30 GLU n 1 31 ASP n 1 32 GLY n 1 33 LYS n 1 34 VAL n 1 35 ILE n 1 36 CYS n 1 37 TRP n 1 38 LEU n 1 39 CYS n 1 40 GLU n 1 41 ARG n 1 42 SER n 1 43 GLN n 1 44 GLU n 1 45 HIS n 1 46 ARG n 1 47 GLY n 1 48 HIS n 1 49 HIS n 1 50 THR n 1 51 PHE n 1 52 PRO n 1 53 THR n 1 54 SER n 1 55 GLY n 1 56 PRO n 1 57 SER n 1 58 SER n 1 59 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TRIM5 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P070115-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRIM5_HUMAN _struct_ref.pdbx_db_accession Q9C035 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLT _struct_ref.pdbx_align_begin 86 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YRG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9C035 _struct_ref_seq.db_align_beg 86 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 53 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YRG GLY A 1 ? UNP Q9C035 ? ? 'expression tag' 1 1 1 2YRG SER A 2 ? UNP Q9C035 ? ? 'expression tag' 2 2 1 2YRG SER A 3 ? UNP Q9C035 ? ? 'expression tag' 3 3 1 2YRG GLY A 4 ? UNP Q9C035 ? ? 'expression tag' 4 4 1 2YRG SER A 5 ? UNP Q9C035 ? ? 'expression tag' 5 5 1 2YRG SER A 6 ? UNP Q9C035 ? ? 'expression tag' 6 6 1 2YRG GLY A 7 ? UNP Q9C035 ? ? 'expression tag' 7 7 1 2YRG PRO A 52 ? UNP Q9C035 LEU 130 'SEE REMARK 999' 52 8 1 2YRG SER A 54 ? UNP Q9C035 ? ? 'expression tag' 54 9 1 2YRG GLY A 55 ? UNP Q9C035 ? ? 'expression tag' 55 10 1 2YRG PRO A 56 ? UNP Q9C035 ? ? 'expression tag' 56 11 1 2YRG SER A 57 ? UNP Q9C035 ? ? 'expression tag' 57 12 1 2YRG SER A 58 ? UNP Q9C035 ? ? 'expression tag' 58 13 1 2YRG GLY A 59 ? UNP Q9C035 ? ? 'expression tag' 59 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.13mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2, 1mM IDA; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 Varian INOVA 800 ? 2 Varian INOVA 900 ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YRG _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2YRG _pdbx_nmr_details.text 'spectrometer_id 1 for 3D_15N_separated_NOESY, spectrometer_id 2 for 3D_13C_separated_NOESY;' # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.entry_id 2YRG _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YRG # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2YRG _exptl.crystals_number ? # _struct.entry_id 2YRG _struct.title 'Solution structure of the B-box domain from tripartite motif-containing protein 5' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YRG _struct_keywords.text ;B-box domain, Tripartite motif-containing protein 5, RING finger protein 88, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE ; _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 36 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 41 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 36 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 41 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 201 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc2 metalc ? ? A HIS 20 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 20 A ZN 201 1_555 ? ? ? ? ? ? ? 2.022 ? ? metalc3 metalc ? ? A CYS 28 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 28 A ZN 401 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc4 metalc ? ? A ASP 31 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 31 A ZN 401 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc5 metalc ? ? A CYS 36 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 36 A ZN 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? metalc6 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 39 A ZN 201 1_555 ? ? ? ? ? ? ? 2.343 ? ? metalc7 metalc ? ? A HIS 45 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 45 A ZN 401 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc8 metalc ? ? A HIS 48 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 48 A ZN 401 1_555 ? ? ? ? ? ? ? 2.055 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 34 ? ILE A 35 ? VAL A 34 ILE A 35 A 2 LEU A 26 ? CYS A 28 ? LEU A 26 CYS A 28 A 3 THR A 50 ? PRO A 52 ? THR A 50 PRO A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 35 ? O ILE A 35 N LEU A 26 ? N LEU A 26 A 2 3 N PHE A 27 ? N PHE A 27 O PHE A 51 ? O PHE A 51 # _atom_sites.entry_id 2YRG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLY 59 59 59 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 20 ? A HIS 20 ? 1_555 116.3 ? 2 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 110.4 ? 3 ND1 ? A HIS 20 ? A HIS 20 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 36 ? A CYS 36 ? 1_555 107.0 ? 4 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 110.9 ? 5 ND1 ? A HIS 20 ? A HIS 20 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 108.3 ? 6 SG ? A CYS 36 ? A CYS 36 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 103.2 ? 7 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 31 ? A ASP 31 ? 1_555 111.1 ? 8 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 118.2 ? 9 OD2 ? A ASP 31 ? A ASP 31 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 99.1 ? 10 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 114.1 ? 11 OD2 ? A ASP 31 ? A ASP 31 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 102.9 ? 12 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 48 ? A HIS 48 ? 1_555 109.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE There is a conflict 130 LEU to PRO in ref.2 BAB55218 ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 12 ? ? -56.08 102.71 2 1 GLN A 43 ? ? -49.65 -17.86 3 1 PRO A 56 ? ? -69.78 80.34 4 2 GLN A 43 ? ? -47.32 -19.96 5 2 PRO A 52 ? ? -69.74 86.52 6 3 PRO A 52 ? ? -69.68 79.82 7 4 LYS A 13 ? ? -54.52 104.36 8 4 GLN A 43 ? ? -49.76 -19.18 9 4 PRO A 52 ? ? -69.70 79.93 10 4 PRO A 56 ? ? -69.76 -177.78 11 5 GLN A 43 ? ? -59.71 -9.18 12 5 PRO A 52 ? ? -69.82 80.02 13 5 PRO A 56 ? ? -69.76 96.93 14 6 SER A 3 ? ? -52.04 105.02 15 6 PRO A 52 ? ? -69.77 80.64 16 7 LYS A 13 ? ? -52.77 106.29 17 7 GLN A 43 ? ? -39.26 -29.49 18 7 PRO A 52 ? ? -69.77 89.17 19 8 PRO A 9 ? ? -69.74 3.09 20 8 GLN A 43 ? ? -49.75 -18.31 21 8 PRO A 52 ? ? -69.74 91.06 22 8 PRO A 56 ? ? -69.77 11.76 23 9 LYS A 13 ? ? -57.37 106.44 24 9 PRO A 52 ? ? -69.77 80.51 25 10 GLU A 30 ? ? -39.83 -39.59 26 10 GLN A 43 ? ? -48.22 -18.69 27 11 GLN A 12 ? ? -58.62 102.11 28 11 PRO A 52 ? ? -69.78 80.13 29 13 PRO A 52 ? ? -69.81 80.33 30 14 GLN A 43 ? ? -48.54 -19.01 31 14 PRO A 52 ? ? -69.83 80.02 32 15 PRO A 9 ? ? -69.81 2.97 33 15 PRO A 52 ? ? -69.76 82.35 34 16 PRO A 52 ? ? -69.76 79.89 35 17 PRO A 9 ? ? -69.73 4.34 36 17 LYS A 13 ? ? -55.84 107.48 37 17 GLN A 43 ? ? -35.25 -32.20 38 17 PRO A 52 ? ? -69.79 82.10 39 18 GLN A 12 ? ? -54.62 103.76 40 18 PRO A 52 ? ? -69.77 90.11 41 19 GLN A 12 ? ? -59.47 107.75 42 19 PRO A 52 ? ? -69.74 79.76 43 19 SER A 58 ? ? -59.99 174.69 44 20 GLU A 10 ? ? 33.60 32.51 45 20 PRO A 52 ? ? -69.76 98.45 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #