data_2YTB # _entry.id 2YTB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YTB pdb_00002ytb 10.2210/pdb2ytb/pdb RCSB RCSB027107 ? ? WWPDB D_1000027107 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002014866.6 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YTB _pdbx_database_status.recvd_initial_deposition_date 2007-04-05 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kasahara, N.' 1 'Tsuda, K.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Terada, T.' 6 'Shirouzu, M.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of C2H2 type Zinc finger domain 5 in Zinc finger protein 32' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kasahara, N.' 1 ? primary 'Tsuda, K.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Terada, T.' 6 ? primary 'Shirouzu, M.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 32' 4214.640 1 ? ? 'zinc-finger motif' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger protein KOX30, C2H2-546' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGGEKPYRCDQCGKAFSQKGSLIVHIRVHTGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGGEKPYRCDQCGKAFSQKGSLIVHIRVHTGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002014866.6 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLY n 1 9 GLU n 1 10 LYS n 1 11 PRO n 1 12 TYR n 1 13 ARG n 1 14 CYS n 1 15 ASP n 1 16 GLN n 1 17 CYS n 1 18 GLY n 1 19 LYS n 1 20 ALA n 1 21 PHE n 1 22 SER n 1 23 GLN n 1 24 LYS n 1 25 GLY n 1 26 SER n 1 27 LEU n 1 28 ILE n 1 29 VAL n 1 30 HIS n 1 31 ILE n 1 32 ARG n 1 33 VAL n 1 34 HIS n 1 35 THR n 1 36 GLY n 1 37 SER n 1 38 GLY n 1 39 PRO n 1 40 SER n 1 41 SER n 1 42 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ZNF32, KOX30' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061204-06 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZNF32_HUMAN _struct_ref.pdbx_db_accession P17041 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GEKPYRCDQCGKAFSQKGSLIVHIRVHTG _struct_ref.pdbx_align_begin 185 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YTB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P17041 _struct_ref_seq.db_align_beg 185 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 213 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 192 _struct_ref_seq.pdbx_auth_seq_align_end 220 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YTB GLY A 1 ? UNP P17041 ? ? 'expression tag' 185 1 1 2YTB SER A 2 ? UNP P17041 ? ? 'expression tag' 186 2 1 2YTB SER A 3 ? UNP P17041 ? ? 'expression tag' 187 3 1 2YTB GLY A 4 ? UNP P17041 ? ? 'expression tag' 188 4 1 2YTB SER A 5 ? UNP P17041 ? ? 'expression tag' 189 5 1 2YTB SER A 6 ? UNP P17041 ? ? 'expression tag' 190 6 1 2YTB GLY A 7 ? UNP P17041 ? ? 'expression tag' 191 7 1 2YTB SER A 37 ? UNP P17041 ? ? 'expression tag' 221 8 1 2YTB GLY A 38 ? UNP P17041 ? ? 'expression tag' 222 9 1 2YTB PRO A 39 ? UNP P17041 ? ? 'expression tag' 223 10 1 2YTB SER A 40 ? UNP P17041 ? ? 'expression tag' 224 11 1 2YTB SER A 41 ? UNP P17041 ? ? 'expression tag' 225 12 1 2YTB GLY A 42 ? UNP P17041 ? ? 'expression tag' 226 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM d-Tris-HCl(pH7.0), 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 0.05mM ZnCl2 +1mM IDA, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2YTB _pdbx_nmr_refine.method 'torsion angle dynamics,restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2YTB _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2YTB _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20060702 Delaglio,F 2 'data analysis' NMRView 5.0.4 Jonson,B.A 3 'data analysis' KUJIRA 0.9820 Kobayashi,N 4 'structure solution' CYANA 2.0.17 Gutert,P 5 refinement CYANA 2.0.17 Gutert,P 6 # _exptl.entry_id 2YTB _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2YTB _struct.title 'Solution structure of C2H2 type Zinc finger domain 5 in Zinc finger protein 32' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YTB _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;Zinc-finger domain, C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 23 ? VAL A 29 ? GLN A 207 VAL A 213 1 ? 7 HELX_P HELX_P2 2 HIS A 30 ? HIS A 34 ? HIS A 214 HIS A 218 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 198 A ZN 301 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 201 A ZN 301 1_555 ? ? ? ? ? ? ? 2.397 ? ? metalc3 metalc ? ? A HIS 30 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 214 A ZN 301 1_555 ? ? ? ? ? ? ? 1.900 ? ? metalc4 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 218 A ZN 301 1_555 ? ? ? ? ? ? ? 1.963 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 14 ? CYS A 198 . ? 1_555 ? 2 AC1 4 CYS A 17 ? CYS A 201 . ? 1_555 ? 3 AC1 4 HIS A 30 ? HIS A 214 . ? 1_555 ? 4 AC1 4 HIS A 34 ? HIS A 218 . ? 1_555 ? # _database_PDB_matrix.entry_id 2YTB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2YTB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 185 185 GLY GLY A . n A 1 2 SER 2 186 186 SER SER A . n A 1 3 SER 3 187 187 SER SER A . n A 1 4 GLY 4 188 188 GLY GLY A . n A 1 5 SER 5 189 189 SER SER A . n A 1 6 SER 6 190 190 SER SER A . n A 1 7 GLY 7 191 191 GLY GLY A . n A 1 8 GLY 8 192 192 GLY GLY A . n A 1 9 GLU 9 193 193 GLU GLU A . n A 1 10 LYS 10 194 194 LYS LYS A . n A 1 11 PRO 11 195 195 PRO PRO A . n A 1 12 TYR 12 196 196 TYR TYR A . n A 1 13 ARG 13 197 197 ARG ARG A . n A 1 14 CYS 14 198 198 CYS CYS A . n A 1 15 ASP 15 199 199 ASP ASP A . n A 1 16 GLN 16 200 200 GLN GLN A . n A 1 17 CYS 17 201 201 CYS CYS A . n A 1 18 GLY 18 202 202 GLY GLY A . n A 1 19 LYS 19 203 203 LYS LYS A . n A 1 20 ALA 20 204 204 ALA ALA A . n A 1 21 PHE 21 205 205 PHE PHE A . n A 1 22 SER 22 206 206 SER SER A . n A 1 23 GLN 23 207 207 GLN GLN A . n A 1 24 LYS 24 208 208 LYS LYS A . n A 1 25 GLY 25 209 209 GLY GLY A . n A 1 26 SER 26 210 210 SER SER A . n A 1 27 LEU 27 211 211 LEU LEU A . n A 1 28 ILE 28 212 212 ILE ILE A . n A 1 29 VAL 29 213 213 VAL VAL A . n A 1 30 HIS 30 214 214 HIS HIS A . n A 1 31 ILE 31 215 215 ILE ILE A . n A 1 32 ARG 32 216 216 ARG ARG A . n A 1 33 VAL 33 217 217 VAL VAL A . n A 1 34 HIS 34 218 218 HIS HIS A . n A 1 35 THR 35 219 219 THR THR A . n A 1 36 GLY 36 220 220 GLY GLY A . n A 1 37 SER 37 221 221 SER SER A . n A 1 38 GLY 38 222 222 GLY GLY A . n A 1 39 PRO 39 223 223 PRO PRO A . n A 1 40 SER 40 224 224 SER SER A . n A 1 41 SER 41 225 225 SER SER A . n A 1 42 GLY 42 226 226 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 301 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 17 ? A CYS 201 ? 1_555 112.8 ? 2 SG ? A CYS 14 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 30 ? A HIS 214 ? 1_555 101.9 ? 3 SG ? A CYS 17 ? A CYS 201 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 30 ? A HIS 214 ? 1_555 100.2 ? 4 SG ? A CYS 14 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 34 ? A HIS 218 ? 1_555 118.8 ? 5 SG ? A CYS 17 ? A CYS 201 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 34 ? A HIS 218 ? 1_555 117.1 ? 6 NE2 ? A HIS 30 ? A HIS 214 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 34 ? A HIS 218 ? 1_555 101.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 187 ? ? -57.35 178.26 2 1 SER A 189 ? ? -157.37 64.72 3 1 HIS A 218 ? ? -95.96 -74.07 4 1 SER A 224 ? ? -157.59 34.70 5 1 SER A 225 ? ? 53.81 -172.02 6 2 HIS A 218 ? ? -97.66 -74.75 7 2 PRO A 223 ? ? -69.78 96.76 8 2 SER A 225 ? ? -152.72 -42.95 9 3 SER A 186 ? ? 56.11 80.53 10 3 HIS A 218 ? ? -98.50 -74.87 11 3 SER A 224 ? ? -156.56 -51.65 12 4 HIS A 218 ? ? -97.53 -74.19 13 4 PRO A 223 ? ? -69.77 93.83 14 5 HIS A 218 ? ? -98.48 -74.87 15 5 SER A 224 ? ? -169.27 94.43 16 5 SER A 225 ? ? -158.82 -47.01 17 6 SER A 189 ? ? -97.19 -67.55 18 6 SER A 190 ? ? 57.56 72.93 19 6 HIS A 218 ? ? -98.34 -75.00 20 6 PRO A 223 ? ? -69.71 97.49 21 7 SER A 189 ? ? 56.99 86.90 22 7 HIS A 218 ? ? -96.51 -74.82 23 7 PRO A 223 ? ? -69.76 -173.40 24 8 SER A 186 ? ? 61.41 -170.14 25 8 SER A 187 ? ? -169.77 -59.00 26 8 HIS A 218 ? ? -93.86 -74.71 27 8 PRO A 223 ? ? -69.74 88.38 28 8 SER A 225 ? ? 57.90 -173.34 29 9 SER A 189 ? ? 54.25 77.55 30 9 HIS A 218 ? ? -98.69 -74.95 31 10 HIS A 218 ? ? -98.95 -75.07 32 11 SER A 190 ? ? -133.35 -58.59 33 11 GLU A 193 ? ? -55.82 -71.45 34 11 HIS A 218 ? ? -91.14 -74.83 35 11 SER A 225 ? ? 58.45 94.87 36 12 HIS A 218 ? ? -98.59 -74.92 37 12 SER A 224 ? ? 61.89 166.79 38 12 SER A 225 ? ? 61.78 167.03 39 13 SER A 186 ? ? -96.62 55.55 40 13 SER A 190 ? ? -176.46 -177.61 41 13 HIS A 218 ? ? -98.43 -74.71 42 13 SER A 221 ? ? -117.02 68.45 43 13 PRO A 223 ? ? -69.78 84.17 44 14 GLU A 193 ? ? -175.13 -36.56 45 14 HIS A 218 ? ? -97.56 -74.09 46 14 SER A 224 ? ? 63.03 -177.63 47 14 SER A 225 ? ? -104.93 57.96 48 15 SER A 186 ? ? -171.08 93.46 49 15 HIS A 218 ? ? -92.33 -75.05 50 16 SER A 190 ? ? 63.16 92.59 51 16 HIS A 218 ? ? -114.80 -75.05 52 16 SER A 221 ? ? 51.76 88.34 53 17 SER A 187 ? ? 62.93 -177.57 54 17 SER A 190 ? ? -103.94 74.54 55 17 HIS A 218 ? ? -93.09 -74.71 56 17 PRO A 223 ? ? -69.82 -171.15 57 18 SER A 187 ? ? 53.55 -170.59 58 18 HIS A 218 ? ? -113.25 -74.81 59 18 SER A 221 ? ? 51.75 88.44 60 19 HIS A 218 ? ? -96.39 -74.78 61 19 SER A 224 ? ? -134.28 -50.52 62 20 HIS A 218 ? ? -117.11 -75.07 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #