data_2Z5V # _entry.id 2Z5V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2Z5V pdb_00002z5v 10.2210/pdb2z5v/pdb RCSB RCSB027559 ? ? WWPDB D_1000027559 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2Z5V _pdbx_database_status.recvd_initial_deposition_date 2007-07-19 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, H.' 1 'Tochio, H.' 2 'Hiroaki, H.' 3 'Kondo, N.' 4 'Kato, Z.' 5 'Shirakawa, M.' 6 # _citation.id primary _citation.title 'Structural basis for the multiple interactions of the MyD88 TIR domain in TLR4 signaling.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 1091-6490 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19506249 _citation.pdbx_database_id_DOI 10.1073/pnas.0812956106 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, H.' 1 ? primary 'Tochio, H.' 2 ? primary 'Kato, Z.' 3 ? primary 'Orii, K.E.' 4 ? primary 'Li, A.' 5 ? primary 'Kimura, T.' 6 ? primary 'Hiroaki, H.' 7 ? primary 'Kondo, N.' 8 ? primary 'Shirakawa, M.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Myeloid differentiation primary response protein MyD88' _entity.formula_weight 17387.318 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'MyD88 TIR domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDY LQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP ; _entity_poly.pdbx_seq_one_letter_code_can ;TTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDY LQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 THR n 1 3 LEU n 1 4 ASP n 1 5 ASP n 1 6 PRO n 1 7 LEU n 1 8 GLY n 1 9 HIS n 1 10 MET n 1 11 PRO n 1 12 GLU n 1 13 ARG n 1 14 PHE n 1 15 ASP n 1 16 ALA n 1 17 PHE n 1 18 ILE n 1 19 CYS n 1 20 TYR n 1 21 CYS n 1 22 PRO n 1 23 SER n 1 24 ASP n 1 25 ILE n 1 26 GLN n 1 27 PHE n 1 28 VAL n 1 29 GLN n 1 30 GLU n 1 31 MET n 1 32 ILE n 1 33 ARG n 1 34 GLN n 1 35 LEU n 1 36 GLU n 1 37 GLN n 1 38 THR n 1 39 ASN n 1 40 TYR n 1 41 ARG n 1 42 LEU n 1 43 LYS n 1 44 LEU n 1 45 CYS n 1 46 VAL n 1 47 SER n 1 48 ASP n 1 49 ARG n 1 50 ASP n 1 51 VAL n 1 52 LEU n 1 53 PRO n 1 54 GLY n 1 55 THR n 1 56 CYS n 1 57 VAL n 1 58 TRP n 1 59 SER n 1 60 ILE n 1 61 ALA n 1 62 SER n 1 63 GLU n 1 64 LEU n 1 65 ILE n 1 66 GLU n 1 67 LYS n 1 68 ARG n 1 69 CYS n 1 70 ARG n 1 71 ARG n 1 72 MET n 1 73 VAL n 1 74 VAL n 1 75 VAL n 1 76 VAL n 1 77 SER n 1 78 ASP n 1 79 ASP n 1 80 TYR n 1 81 LEU n 1 82 GLN n 1 83 SER n 1 84 LYS n 1 85 GLU n 1 86 CYS n 1 87 ASP n 1 88 PHE n 1 89 GLN n 1 90 THR n 1 91 LYS n 1 92 PHE n 1 93 ALA n 1 94 LEU n 1 95 SER n 1 96 LEU n 1 97 SER n 1 98 PRO n 1 99 GLY n 1 100 ALA n 1 101 HIS n 1 102 GLN n 1 103 LYS n 1 104 ARG n 1 105 LEU n 1 106 ILE n 1 107 PRO n 1 108 ILE n 1 109 LYS n 1 110 TYR n 1 111 LYS n 1 112 ALA n 1 113 MET n 1 114 LYS n 1 115 LYS n 1 116 GLU n 1 117 PHE n 1 118 PRO n 1 119 SER n 1 120 ILE n 1 121 LEU n 1 122 ARG n 1 123 PHE n 1 124 ILE n 1 125 THR n 1 126 VAL n 1 127 CYS n 1 128 ASP n 1 129 TYR n 1 130 THR n 1 131 ASN n 1 132 PRO n 1 133 CYS n 1 134 THR n 1 135 LYS n 1 136 SER n 1 137 TRP n 1 138 PHE n 1 139 TRP n 1 140 THR n 1 141 ARG n 1 142 LEU n 1 143 ALA n 1 144 LYS n 1 145 ALA n 1 146 LEU n 1 147 SER n 1 148 LEU n 1 149 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MYD88 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL-21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-5X-3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYD88_HUMAN _struct_ref.pdbx_db_accession Q99836 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDY LQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP ; _struct_ref.pdbx_align_begin 148 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2Z5V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99836 _struct_ref_seq.db_align_beg 148 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 296 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH ? _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_ensemble.entry_id 2Z5V _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2Z5V _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version 1.1 _pdbx_nmr_software.authors ? _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 2Z5V _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2Z5V _struct.title 'Solution structure of the TIR domain of human MyD88' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2Z5V _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'signal transduction innate immunity, Cytoplasm, Immune response, Inflammatory response, IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 24 ? GLN A 37 ? ASP A 24 GLN A 37 1 ? 14 HELX_P HELX_P2 2 SER A 77 ? GLN A 82 ? SER A 77 GLN A 82 1 ? 6 HELX_P HELX_P3 3 SER A 83 ? SER A 95 ? SER A 83 SER A 95 1 ? 13 HELX_P HELX_P4 4 ASN A 131 ? SER A 136 ? ASN A 131 SER A 136 1 ? 6 HELX_P HELX_P5 5 TRP A 137 ? SER A 147 ? TRP A 137 SER A 147 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 44 ? CYS A 45 ? LEU A 44 CYS A 45 A 2 ALA A 16 ? CYS A 19 ? ALA A 16 CYS A 19 A 3 ARG A 71 ? VAL A 75 ? ARG A 71 VAL A 75 A 4 LEU A 105 ? LYS A 109 ? LEU A 105 LYS A 109 A 5 CYS A 127 ? ASP A 128 ? CYS A 127 ASP A 128 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 45 ? O CYS A 45 N ILE A 18 ? N ILE A 18 A 2 3 N CYS A 19 ? N CYS A 19 O VAL A 73 ? O VAL A 73 A 3 4 N MET A 72 ? N MET A 72 O ILE A 106 ? O ILE A 106 A 4 5 N LYS A 109 ? N LYS A 109 O CYS A 127 ? O CYS A 127 # _database_PDB_matrix.entry_id 2Z5V _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2Z5V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 TRP 137 137 137 TRP TRP A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 TRP 139 139 139 TRP TRP A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 PRO 149 149 149 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A THR 90 ? ? H A LEU 94 ? ? 1.47 2 1 O A PRO 118 ? ? H A ILE 120 ? ? 1.60 3 2 O A THR 90 ? ? H A LEU 94 ? ? 1.45 4 2 O A PRO 118 ? ? H A ILE 120 ? ? 1.59 5 3 O A THR 90 ? ? H A LEU 94 ? ? 1.56 6 4 O A THR 90 ? ? H A LEU 94 ? ? 1.45 7 4 O A PRO 118 ? ? H A ILE 120 ? ? 1.59 8 5 O A THR 90 ? ? H A LEU 94 ? ? 1.44 9 6 O A THR 90 ? ? H A LEU 94 ? ? 1.55 10 6 O A PRO 118 ? ? H A ILE 120 ? ? 1.59 11 7 O A THR 90 ? ? H A LEU 94 ? ? 1.43 12 7 O A PRO 118 ? ? H A ILE 120 ? ? 1.58 13 8 O A THR 90 ? ? H A LEU 94 ? ? 1.44 14 9 O A THR 90 ? ? H A LEU 94 ? ? 1.56 15 9 O A PRO 118 ? ? H A ILE 120 ? ? 1.60 16 10 O A THR 90 ? ? H A LEU 94 ? ? 1.45 17 10 O A PRO 118 ? ? H A ILE 120 ? ? 1.59 18 11 O A THR 90 ? ? H A LEU 94 ? ? 1.41 19 11 O A PRO 118 ? ? H A ILE 120 ? ? 1.60 20 12 O A THR 90 ? ? H A LEU 94 ? ? 1.56 21 13 O A THR 90 ? ? H A LEU 94 ? ? 1.50 22 13 O A PRO 118 ? ? H A ILE 120 ? ? 1.57 23 14 O A THR 90 ? ? H A LEU 94 ? ? 1.42 24 15 O A THR 90 ? ? H A LEU 94 ? ? 1.47 25 15 O A PRO 118 ? ? H A ILE 120 ? ? 1.58 26 16 O A THR 90 ? ? H A LEU 94 ? ? 1.46 27 16 O A PRO 118 ? ? H A ILE 120 ? ? 1.59 28 17 O A THR 90 ? ? H A LEU 94 ? ? 1.43 29 17 O A PRO 118 ? ? H A ILE 120 ? ? 1.60 30 18 O A THR 90 ? ? H A LEU 94 ? ? 1.55 31 18 O A PRO 118 ? ? H A ILE 120 ? ? 1.59 32 19 O A THR 90 ? ? H A LEU 94 ? ? 1.55 33 19 O A PRO 118 ? ? H A ILE 120 ? ? 1.57 34 20 O A THR 90 ? ? H A LEU 94 ? ? 1.53 35 20 O A PRO 118 ? ? H A ILE 120 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 10 ? ? -41.45 99.56 2 1 PRO A 11 ? ? -71.99 -167.60 3 1 ASP A 15 ? ? -98.57 -65.42 4 1 ASP A 24 ? ? -150.12 50.57 5 1 THR A 38 ? ? -52.16 -179.72 6 1 LEU A 52 ? ? -107.48 79.84 7 1 ARG A 68 ? ? -97.16 -61.50 8 1 SER A 95 ? ? -107.58 54.91 9 1 LEU A 96 ? ? -80.32 -78.46 10 1 ALA A 100 ? ? -142.37 45.76 11 1 GLN A 102 ? ? -150.90 28.28 12 1 LYS A 111 ? ? 176.37 163.86 13 1 LYS A 115 ? ? -108.70 -161.22 14 1 SER A 119 ? ? -66.73 69.45 15 1 ILE A 120 ? ? -148.69 -45.16 16 1 PHE A 123 ? ? -170.57 31.18 17 1 THR A 125 ? ? -57.47 98.94 18 1 ASN A 131 ? ? -157.11 53.01 19 2 MET A 10 ? ? 59.79 74.03 20 2 PRO A 11 ? ? -51.37 176.34 21 2 ASP A 15 ? ? -92.82 -65.11 22 2 ASP A 48 ? ? -178.33 -177.32 23 2 ARG A 49 ? ? -125.59 -58.19 24 2 ASP A 50 ? ? -113.80 74.01 25 2 VAL A 51 ? ? -131.66 -44.31 26 2 SER A 95 ? ? -109.47 55.76 27 2 LEU A 96 ? ? -80.06 -78.51 28 2 ALA A 100 ? ? -145.37 42.43 29 2 GLN A 102 ? ? -145.25 30.86 30 2 LYS A 111 ? ? 170.73 -170.05 31 2 LYS A 115 ? ? -103.46 -160.49 32 2 SER A 119 ? ? -66.74 68.94 33 2 ILE A 120 ? ? -149.17 -45.38 34 2 PHE A 123 ? ? -164.37 27.66 35 2 THR A 125 ? ? -56.63 101.71 36 3 MET A 10 ? ? 55.70 83.13 37 3 PRO A 11 ? ? -61.42 -172.24 38 3 ASP A 15 ? ? -93.33 -68.38 39 3 ASN A 39 ? ? -174.76 35.49 40 3 ARG A 49 ? ? -169.49 -48.33 41 3 ASP A 50 ? ? -174.48 36.95 42 3 PRO A 53 ? ? -53.51 173.36 43 3 SER A 95 ? ? -106.23 53.53 44 3 LEU A 96 ? ? -82.39 -80.51 45 3 LYS A 111 ? ? 179.21 149.90 46 3 LYS A 115 ? ? -108.24 -160.31 47 3 SER A 119 ? ? -67.16 70.10 48 3 ILE A 120 ? ? -149.37 -44.55 49 3 PHE A 123 ? ? -165.55 26.96 50 3 THR A 125 ? ? -58.90 99.32 51 3 ASN A 131 ? ? 76.36 64.52 52 3 CYS A 133 ? ? -39.11 -37.90 53 4 MET A 10 ? ? 178.42 153.55 54 4 ASP A 15 ? ? -107.10 -60.71 55 4 THR A 38 ? ? -55.52 89.80 56 4 SER A 47 ? ? -59.34 -79.37 57 4 ASP A 50 ? ? -152.70 37.06 58 4 VAL A 51 ? ? -145.76 -44.15 59 4 CYS A 56 ? ? -177.05 53.27 60 4 ARG A 68 ? ? -97.63 -61.32 61 4 SER A 95 ? ? -113.92 58.11 62 4 LEU A 96 ? ? -81.34 -80.84 63 4 GLN A 102 ? ? -149.87 34.39 64 4 LYS A 109 ? ? -171.20 149.68 65 4 LYS A 115 ? ? -111.55 -159.92 66 4 SER A 119 ? ? -66.69 68.82 67 4 ILE A 120 ? ? -149.59 -45.62 68 4 PHE A 123 ? ? -163.86 28.09 69 4 THR A 125 ? ? -59.35 98.89 70 4 SER A 136 ? ? -38.87 -29.51 71 4 SER A 147 ? ? -144.66 46.49 72 5 PRO A 11 ? ? -57.01 -162.57 73 5 ASP A 15 ? ? -96.62 -66.89 74 5 TYR A 40 ? ? -96.69 38.24 75 5 ARG A 41 ? ? -157.40 28.05 76 5 SER A 47 ? ? -59.53 -177.46 77 5 ASP A 48 ? ? -67.99 -179.19 78 5 ARG A 49 ? ? -69.97 99.23 79 5 ASP A 50 ? ? -177.34 -39.62 80 5 CYS A 56 ? ? -158.35 32.07 81 5 ARG A 68 ? ? -102.18 -62.48 82 5 SER A 95 ? ? -110.88 56.35 83 5 LEU A 96 ? ? -81.96 -80.65 84 5 ALA A 100 ? ? -152.50 44.36 85 5 GLN A 102 ? ? -142.83 32.26 86 5 LYS A 109 ? ? -173.21 145.30 87 5 LYS A 115 ? ? -111.45 -160.50 88 5 SER A 119 ? ? -68.72 68.76 89 5 ILE A 120 ? ? -147.08 -46.60 90 5 PHE A 123 ? ? -169.78 30.05 91 5 THR A 125 ? ? -59.13 99.03 92 5 ASN A 131 ? ? -142.49 52.90 93 5 SER A 147 ? ? -149.38 42.02 94 6 MET A 10 ? ? -173.92 83.23 95 6 PRO A 11 ? ? -59.87 -167.13 96 6 ASN A 39 ? ? 65.00 -76.32 97 6 VAL A 51 ? ? -142.88 -47.42 98 6 SER A 95 ? ? -106.30 53.80 99 6 LEU A 96 ? ? -81.91 -79.28 100 6 ALA A 100 ? ? -145.48 41.45 101 6 LYS A 109 ? ? -174.71 146.36 102 6 LYS A 115 ? ? -105.37 -161.34 103 6 SER A 119 ? ? -64.63 70.82 104 6 ILE A 120 ? ? -151.65 -45.27 105 6 PHE A 123 ? ? -164.84 27.05 106 6 THR A 125 ? ? -54.96 99.71 107 6 ASN A 131 ? ? -150.42 51.18 108 6 SER A 147 ? ? -140.03 46.17 109 7 MET A 10 ? ? -176.36 94.54 110 7 ASP A 15 ? ? -101.67 -63.56 111 7 ARG A 41 ? ? -164.05 67.29 112 7 ASP A 48 ? ? 179.00 171.50 113 7 ASP A 50 ? ? 59.62 106.64 114 7 VAL A 51 ? ? -151.47 -43.70 115 7 THR A 55 ? ? 55.30 -89.30 116 7 CYS A 56 ? ? 169.96 137.61 117 7 SER A 95 ? ? -110.12 55.73 118 7 LEU A 96 ? ? -81.35 -79.18 119 7 PRO A 98 ? ? -62.46 79.01 120 7 ALA A 100 ? ? -140.87 31.10 121 7 GLN A 102 ? ? -152.28 33.09 122 7 LYS A 109 ? ? -174.06 148.98 123 7 LYS A 111 ? ? -178.80 147.52 124 7 LYS A 115 ? ? -114.40 -158.30 125 7 SER A 119 ? ? -67.30 68.03 126 7 ILE A 120 ? ? -148.19 -45.42 127 7 PHE A 123 ? ? -160.78 26.69 128 7 THR A 125 ? ? -62.96 99.27 129 7 ASN A 131 ? ? 72.47 54.72 130 8 MET A 10 ? ? -49.96 104.22 131 8 PRO A 11 ? ? -58.53 -162.73 132 8 ASP A 15 ? ? -103.15 -61.08 133 8 THR A 38 ? ? -53.37 -177.04 134 8 ARG A 49 ? ? -142.33 30.41 135 8 ASP A 50 ? ? 179.68 -38.46 136 8 LEU A 52 ? ? 58.25 75.65 137 8 THR A 55 ? ? -155.73 -66.28 138 8 CYS A 56 ? ? -178.75 46.21 139 8 SER A 95 ? ? -109.23 55.26 140 8 LEU A 96 ? ? -82.48 -80.49 141 8 ALA A 100 ? ? -151.41 37.42 142 8 GLN A 102 ? ? -143.27 30.07 143 8 LYS A 115 ? ? -109.28 -161.20 144 8 SER A 119 ? ? -67.90 68.89 145 8 ILE A 120 ? ? -148.25 -46.08 146 8 PHE A 123 ? ? -166.32 29.15 147 8 THR A 125 ? ? -58.32 99.08 148 8 SER A 147 ? ? -150.85 36.64 149 9 PRO A 11 ? ? -51.75 -175.18 150 9 ASP A 15 ? ? -82.95 -70.53 151 9 TYR A 40 ? ? 56.94 88.20 152 9 ARG A 41 ? ? -173.21 -44.93 153 9 ASP A 48 ? ? 60.78 176.68 154 9 ASP A 50 ? ? -141.16 31.67 155 9 PRO A 53 ? ? -57.32 -161.10 156 9 THR A 55 ? ? -142.72 -60.61 157 9 SER A 95 ? ? -104.90 52.80 158 9 LEU A 96 ? ? -82.33 -79.84 159 9 ALA A 100 ? ? -142.73 44.06 160 9 GLN A 102 ? ? -141.62 28.24 161 9 LYS A 111 ? ? 175.19 163.92 162 9 LYS A 115 ? ? -109.08 -161.08 163 9 SER A 119 ? ? -62.91 71.78 164 9 ILE A 120 ? ? -152.42 -45.32 165 9 PHE A 123 ? ? -168.90 29.08 166 9 THR A 125 ? ? -59.74 99.14 167 9 ASN A 131 ? ? -142.59 53.48 168 10 MET A 10 ? ? -59.50 108.30 169 10 PRO A 11 ? ? -67.73 -167.07 170 10 ASP A 15 ? ? -93.10 -68.97 171 10 PRO A 22 ? ? -63.38 3.22 172 10 ASN A 39 ? ? 59.68 97.67 173 10 TYR A 40 ? ? -60.02 87.31 174 10 ARG A 41 ? ? -166.98 -42.22 175 10 ASP A 48 ? ? -64.10 -76.39 176 10 ASP A 50 ? ? -153.15 -46.01 177 10 THR A 55 ? ? -179.12 123.63 178 10 CYS A 56 ? ? -64.77 89.94 179 10 SER A 95 ? ? -112.19 57.21 180 10 LEU A 96 ? ? -81.02 -80.52 181 10 ALA A 100 ? ? -148.11 46.73 182 10 GLN A 102 ? ? -141.05 27.88 183 10 LYS A 115 ? ? -109.36 -160.53 184 10 SER A 119 ? ? -68.80 67.50 185 10 ILE A 120 ? ? -148.45 -45.98 186 10 PHE A 123 ? ? -163.36 29.46 187 10 THR A 125 ? ? -58.91 99.02 188 10 ASN A 131 ? ? -119.90 59.77 189 11 PRO A 11 ? ? -50.18 178.73 190 11 ASN A 39 ? ? 67.17 74.52 191 11 TYR A 40 ? ? 60.07 158.17 192 11 ARG A 49 ? ? -150.95 -71.23 193 11 ASP A 50 ? ? -176.36 45.35 194 11 THR A 55 ? ? -106.22 47.63 195 11 CYS A 56 ? ? -156.38 41.72 196 11 ARG A 68 ? ? -90.16 -62.01 197 11 SER A 95 ? ? -112.34 56.78 198 11 LEU A 96 ? ? -82.31 -81.76 199 11 PRO A 98 ? ? -66.65 80.86 200 11 ALA A 100 ? ? -141.02 31.29 201 11 GLN A 102 ? ? -153.57 23.67 202 11 LYS A 109 ? ? -175.46 146.88 203 11 LYS A 115 ? ? -109.14 -159.60 204 11 SER A 119 ? ? -67.49 68.65 205 11 ILE A 120 ? ? -149.25 -45.58 206 11 PHE A 123 ? ? -168.58 30.74 207 11 THR A 125 ? ? -58.09 99.22 208 11 SER A 147 ? ? -143.56 49.51 209 12 PRO A 11 ? ? -68.65 -166.94 210 12 ASP A 15 ? ? -103.56 -61.53 211 12 ASP A 48 ? ? -175.52 -170.19 212 12 PRO A 53 ? ? -68.82 -170.00 213 12 CYS A 56 ? ? 63.11 142.47 214 12 SER A 95 ? ? -108.48 55.33 215 12 LEU A 96 ? ? -81.64 -81.08 216 12 ALA A 100 ? ? -147.95 46.57 217 12 LYS A 115 ? ? -108.77 -160.52 218 12 SER A 119 ? ? -62.54 72.02 219 12 ILE A 120 ? ? -154.23 -45.40 220 12 PHE A 123 ? ? -162.28 23.96 221 12 THR A 125 ? ? -53.37 99.09 222 12 ASN A 131 ? ? 70.83 58.08 223 12 CYS A 133 ? ? -36.40 -38.24 224 12 LEU A 148 ? ? -43.49 161.99 225 13 PRO A 11 ? ? -53.69 -176.61 226 13 ASP A 15 ? ? -97.87 -63.89 227 13 ASP A 24 ? ? -147.19 31.97 228 13 ASP A 50 ? ? -179.78 -38.82 229 13 SER A 95 ? ? -107.73 54.13 230 13 LEU A 96 ? ? -81.95 -79.53 231 13 ALA A 100 ? ? -145.63 36.08 232 13 LYS A 111 ? ? 171.43 -169.99 233 13 LYS A 115 ? ? -109.72 -159.46 234 13 SER A 119 ? ? -65.89 69.24 235 13 ILE A 120 ? ? -149.02 -44.08 236 13 PHE A 123 ? ? -159.44 22.69 237 13 THR A 125 ? ? -56.09 98.62 238 13 LEU A 148 ? ? -109.57 -68.93 239 14 MET A 10 ? ? -167.32 80.71 240 14 PRO A 11 ? ? -62.70 -179.20 241 14 ASP A 15 ? ? -100.22 -65.63 242 14 ASN A 39 ? ? 60.03 -177.90 243 14 TYR A 40 ? ? -60.96 -177.05 244 14 ARG A 41 ? ? -57.37 90.79 245 14 ASP A 48 ? ? -98.27 44.54 246 14 ASP A 50 ? ? -166.41 41.20 247 14 VAL A 51 ? ? -121.53 -68.38 248 14 CYS A 56 ? ? -171.73 54.34 249 14 ARG A 68 ? ? -95.70 -61.39 250 14 SER A 95 ? ? -110.19 56.16 251 14 LEU A 96 ? ? -81.22 -79.08 252 14 ALA A 100 ? ? -148.50 36.80 253 14 GLN A 102 ? ? -149.15 31.52 254 14 LYS A 115 ? ? -110.08 -160.70 255 14 SER A 119 ? ? -67.67 68.68 256 14 ILE A 120 ? ? -149.19 -44.69 257 14 PHE A 123 ? ? -164.89 29.65 258 14 THR A 125 ? ? -59.17 99.08 259 14 SER A 147 ? ? -166.94 43.47 260 15 PRO A 11 ? ? -49.10 171.37 261 15 ARG A 41 ? ? -159.57 -39.18 262 15 ASP A 48 ? ? -105.14 43.75 263 15 ARG A 49 ? ? -105.29 -67.07 264 15 ASP A 50 ? ? -148.29 30.82 265 15 SER A 95 ? ? -112.29 57.70 266 15 LEU A 96 ? ? -80.62 -79.89 267 15 ALA A 100 ? ? -145.71 34.11 268 15 GLN A 102 ? ? -149.15 31.77 269 15 LYS A 115 ? ? -110.87 -159.17 270 15 SER A 119 ? ? -66.92 68.34 271 15 ILE A 120 ? ? -149.19 -46.00 272 15 PHE A 123 ? ? -167.05 29.69 273 15 THR A 125 ? ? -56.59 99.17 274 15 PRO A 132 ? ? -38.54 -32.53 275 16 MET A 10 ? ? 56.22 80.62 276 16 PRO A 11 ? ? -62.15 -174.68 277 16 ASN A 39 ? ? 73.84 -74.42 278 16 TYR A 40 ? ? 177.98 -70.38 279 16 ASP A 48 ? ? -102.53 79.19 280 16 ARG A 49 ? ? -139.35 -73.97 281 16 ASP A 50 ? ? -176.73 38.39 282 16 SER A 95 ? ? -110.75 56.52 283 16 LEU A 96 ? ? -81.63 -80.39 284 16 ALA A 100 ? ? -145.48 36.79 285 16 LYS A 115 ? ? -108.10 -158.89 286 16 SER A 119 ? ? -67.75 68.36 287 16 ILE A 120 ? ? -149.75 -46.23 288 16 PHE A 123 ? ? -164.65 28.74 289 16 THR A 125 ? ? -58.47 99.12 290 16 ASN A 131 ? ? -144.35 54.46 291 17 MET A 10 ? ? 59.69 71.94 292 17 PRO A 11 ? ? -55.05 -168.42 293 17 ASP A 15 ? ? -84.18 -70.82 294 17 ASN A 39 ? ? -177.96 -74.35 295 17 TYR A 40 ? ? 171.05 -63.47 296 17 ARG A 41 ? ? -152.29 36.09 297 17 ARG A 49 ? ? -165.18 -53.40 298 17 ASP A 50 ? ? -171.06 44.00 299 17 CYS A 56 ? ? 62.69 73.80 300 17 SER A 95 ? ? -109.08 54.84 301 17 LEU A 96 ? ? -81.64 -80.06 302 17 ALA A 100 ? ? -151.14 48.62 303 17 LYS A 111 ? ? 171.95 144.96 304 17 LYS A 115 ? ? -115.19 -160.00 305 17 SER A 119 ? ? -67.06 69.09 306 17 ILE A 120 ? ? -148.40 -45.60 307 17 PHE A 123 ? ? -169.04 30.28 308 17 THR A 125 ? ? -60.08 99.13 309 17 PRO A 132 ? ? -36.67 -32.59 310 17 SER A 147 ? ? -146.68 29.04 311 18 MET A 10 ? ? 61.55 78.62 312 18 PRO A 11 ? ? -55.44 -165.49 313 18 ASP A 15 ? ? -94.91 -66.45 314 18 ASP A 24 ? ? -148.05 51.72 315 18 THR A 38 ? ? -50.60 175.11 316 18 ASN A 39 ? ? -71.62 -78.68 317 18 ARG A 41 ? ? -173.75 -53.74 318 18 SER A 47 ? ? -150.72 58.85 319 18 VAL A 51 ? ? -154.69 -50.93 320 18 THR A 55 ? ? 68.77 -67.02 321 18 CYS A 56 ? ? -173.18 86.21 322 18 SER A 95 ? ? -105.55 53.72 323 18 LEU A 96 ? ? -81.63 -80.28 324 18 ALA A 100 ? ? -145.26 45.94 325 18 GLN A 102 ? ? -146.55 24.06 326 18 LYS A 111 ? ? -172.10 -168.87 327 18 LYS A 115 ? ? -88.44 -157.86 328 18 SER A 119 ? ? -61.35 71.91 329 18 ILE A 120 ? ? -149.34 -45.26 330 18 PHE A 123 ? ? -165.66 28.83 331 18 THR A 125 ? ? -58.54 98.95 332 19 PRO A 11 ? ? -70.30 -168.11 333 19 ASP A 15 ? ? -77.66 -70.09 334 19 THR A 38 ? ? -53.08 -178.97 335 19 ASP A 50 ? ? -176.66 -42.34 336 19 LEU A 52 ? ? 60.92 65.14 337 19 THR A 55 ? ? -152.15 -50.38 338 19 SER A 95 ? ? -108.15 55.03 339 19 LEU A 96 ? ? -82.19 -80.23 340 19 ALA A 100 ? ? -150.73 48.89 341 19 GLN A 102 ? ? -147.14 29.40 342 19 LYS A 109 ? ? -175.01 141.39 343 19 TYR A 110 ? ? -96.79 42.56 344 19 LYS A 111 ? ? 173.79 -176.96 345 19 LYS A 115 ? ? -109.64 -159.81 346 19 SER A 119 ? ? -63.58 70.56 347 19 ILE A 120 ? ? -151.86 -44.38 348 19 PHE A 123 ? ? -163.96 26.93 349 19 THR A 125 ? ? -57.69 98.75 350 20 MET A 10 ? ? -177.02 101.85 351 20 ASP A 15 ? ? -80.57 -70.25 352 20 ASP A 24 ? ? -144.38 47.31 353 20 THR A 38 ? ? -107.09 -163.75 354 20 ASN A 39 ? ? 64.66 -79.69 355 20 ARG A 41 ? ? -69.13 69.91 356 20 ARG A 49 ? ? -145.34 -47.12 357 20 ASP A 50 ? ? -155.05 -45.04 358 20 LEU A 52 ? ? 58.91 105.86 359 20 THR A 55 ? ? -131.56 -56.40 360 20 CYS A 56 ? ? -151.19 47.04 361 20 SER A 95 ? ? -100.94 50.93 362 20 LEU A 96 ? ? -76.86 -73.59 363 20 ALA A 100 ? ? -144.14 43.35 364 20 GLN A 102 ? ? -148.71 32.83 365 20 TYR A 110 ? ? -98.89 31.06 366 20 LYS A 111 ? ? -177.59 -171.28 367 20 LYS A 115 ? ? -115.32 -160.73 368 20 SER A 119 ? ? -64.07 70.25 369 20 ILE A 120 ? ? -150.69 -43.29 370 20 PHE A 123 ? ? -164.68 29.34 371 20 THR A 125 ? ? -57.00 98.72 372 20 ASN A 131 ? ? -151.19 51.95 373 20 LEU A 148 ? ? -44.80 161.56 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 2 Y 1 A THR 1 ? A THR 1 10 2 Y 1 A THR 2 ? A THR 2 11 2 Y 1 A LEU 3 ? A LEU 3 12 2 Y 1 A ASP 4 ? A ASP 4 13 2 Y 1 A ASP 5 ? A ASP 5 14 2 Y 1 A PRO 6 ? A PRO 6 15 2 Y 1 A LEU 7 ? A LEU 7 16 2 Y 1 A GLY 8 ? A GLY 8 17 3 Y 1 A THR 1 ? A THR 1 18 3 Y 1 A THR 2 ? A THR 2 19 3 Y 1 A LEU 3 ? A LEU 3 20 3 Y 1 A ASP 4 ? A ASP 4 21 3 Y 1 A ASP 5 ? A ASP 5 22 3 Y 1 A PRO 6 ? A PRO 6 23 3 Y 1 A LEU 7 ? A LEU 7 24 3 Y 1 A GLY 8 ? A GLY 8 25 4 Y 1 A THR 1 ? A THR 1 26 4 Y 1 A THR 2 ? A THR 2 27 4 Y 1 A LEU 3 ? A LEU 3 28 4 Y 1 A ASP 4 ? A ASP 4 29 4 Y 1 A ASP 5 ? A ASP 5 30 4 Y 1 A PRO 6 ? A PRO 6 31 4 Y 1 A LEU 7 ? A LEU 7 32 4 Y 1 A GLY 8 ? A GLY 8 33 5 Y 1 A THR 1 ? A THR 1 34 5 Y 1 A THR 2 ? A THR 2 35 5 Y 1 A LEU 3 ? A LEU 3 36 5 Y 1 A ASP 4 ? A ASP 4 37 5 Y 1 A ASP 5 ? A ASP 5 38 5 Y 1 A PRO 6 ? A PRO 6 39 5 Y 1 A LEU 7 ? A LEU 7 40 5 Y 1 A GLY 8 ? A GLY 8 41 6 Y 1 A THR 1 ? A THR 1 42 6 Y 1 A THR 2 ? A THR 2 43 6 Y 1 A LEU 3 ? A LEU 3 44 6 Y 1 A ASP 4 ? A ASP 4 45 6 Y 1 A ASP 5 ? A ASP 5 46 6 Y 1 A PRO 6 ? A PRO 6 47 6 Y 1 A LEU 7 ? A LEU 7 48 6 Y 1 A GLY 8 ? A GLY 8 49 7 Y 1 A THR 1 ? A THR 1 50 7 Y 1 A THR 2 ? A THR 2 51 7 Y 1 A LEU 3 ? A LEU 3 52 7 Y 1 A ASP 4 ? A ASP 4 53 7 Y 1 A ASP 5 ? A ASP 5 54 7 Y 1 A PRO 6 ? A PRO 6 55 7 Y 1 A LEU 7 ? A LEU 7 56 7 Y 1 A GLY 8 ? A GLY 8 57 8 Y 1 A THR 1 ? A THR 1 58 8 Y 1 A THR 2 ? A THR 2 59 8 Y 1 A LEU 3 ? A LEU 3 60 8 Y 1 A ASP 4 ? A ASP 4 61 8 Y 1 A ASP 5 ? A ASP 5 62 8 Y 1 A PRO 6 ? A PRO 6 63 8 Y 1 A LEU 7 ? A LEU 7 64 8 Y 1 A GLY 8 ? A GLY 8 65 9 Y 1 A THR 1 ? A THR 1 66 9 Y 1 A THR 2 ? A THR 2 67 9 Y 1 A LEU 3 ? A LEU 3 68 9 Y 1 A ASP 4 ? A ASP 4 69 9 Y 1 A ASP 5 ? A ASP 5 70 9 Y 1 A PRO 6 ? A PRO 6 71 9 Y 1 A LEU 7 ? A LEU 7 72 9 Y 1 A GLY 8 ? A GLY 8 73 10 Y 1 A THR 1 ? A THR 1 74 10 Y 1 A THR 2 ? A THR 2 75 10 Y 1 A LEU 3 ? A LEU 3 76 10 Y 1 A ASP 4 ? A ASP 4 77 10 Y 1 A ASP 5 ? A ASP 5 78 10 Y 1 A PRO 6 ? A PRO 6 79 10 Y 1 A LEU 7 ? A LEU 7 80 10 Y 1 A GLY 8 ? A GLY 8 81 11 Y 1 A THR 1 ? A THR 1 82 11 Y 1 A THR 2 ? A THR 2 83 11 Y 1 A LEU 3 ? A LEU 3 84 11 Y 1 A ASP 4 ? A ASP 4 85 11 Y 1 A ASP 5 ? A ASP 5 86 11 Y 1 A PRO 6 ? A PRO 6 87 11 Y 1 A LEU 7 ? A LEU 7 88 11 Y 1 A GLY 8 ? A GLY 8 89 12 Y 1 A THR 1 ? A THR 1 90 12 Y 1 A THR 2 ? A THR 2 91 12 Y 1 A LEU 3 ? A LEU 3 92 12 Y 1 A ASP 4 ? A ASP 4 93 12 Y 1 A ASP 5 ? A ASP 5 94 12 Y 1 A PRO 6 ? A PRO 6 95 12 Y 1 A LEU 7 ? A LEU 7 96 12 Y 1 A GLY 8 ? A GLY 8 97 13 Y 1 A THR 1 ? A THR 1 98 13 Y 1 A THR 2 ? A THR 2 99 13 Y 1 A LEU 3 ? A LEU 3 100 13 Y 1 A ASP 4 ? A ASP 4 101 13 Y 1 A ASP 5 ? A ASP 5 102 13 Y 1 A PRO 6 ? A PRO 6 103 13 Y 1 A LEU 7 ? A LEU 7 104 13 Y 1 A GLY 8 ? A GLY 8 105 14 Y 1 A THR 1 ? A THR 1 106 14 Y 1 A THR 2 ? A THR 2 107 14 Y 1 A LEU 3 ? A LEU 3 108 14 Y 1 A ASP 4 ? A ASP 4 109 14 Y 1 A ASP 5 ? A ASP 5 110 14 Y 1 A PRO 6 ? A PRO 6 111 14 Y 1 A LEU 7 ? A LEU 7 112 14 Y 1 A GLY 8 ? A GLY 8 113 15 Y 1 A THR 1 ? A THR 1 114 15 Y 1 A THR 2 ? A THR 2 115 15 Y 1 A LEU 3 ? A LEU 3 116 15 Y 1 A ASP 4 ? A ASP 4 117 15 Y 1 A ASP 5 ? A ASP 5 118 15 Y 1 A PRO 6 ? A PRO 6 119 15 Y 1 A LEU 7 ? A LEU 7 120 15 Y 1 A GLY 8 ? A GLY 8 121 16 Y 1 A THR 1 ? A THR 1 122 16 Y 1 A THR 2 ? A THR 2 123 16 Y 1 A LEU 3 ? A LEU 3 124 16 Y 1 A ASP 4 ? A ASP 4 125 16 Y 1 A ASP 5 ? A ASP 5 126 16 Y 1 A PRO 6 ? A PRO 6 127 16 Y 1 A LEU 7 ? A LEU 7 128 16 Y 1 A GLY 8 ? A GLY 8 129 17 Y 1 A THR 1 ? A THR 1 130 17 Y 1 A THR 2 ? A THR 2 131 17 Y 1 A LEU 3 ? A LEU 3 132 17 Y 1 A ASP 4 ? A ASP 4 133 17 Y 1 A ASP 5 ? A ASP 5 134 17 Y 1 A PRO 6 ? A PRO 6 135 17 Y 1 A LEU 7 ? A LEU 7 136 17 Y 1 A GLY 8 ? A GLY 8 137 18 Y 1 A THR 1 ? A THR 1 138 18 Y 1 A THR 2 ? A THR 2 139 18 Y 1 A LEU 3 ? A LEU 3 140 18 Y 1 A ASP 4 ? A ASP 4 141 18 Y 1 A ASP 5 ? A ASP 5 142 18 Y 1 A PRO 6 ? A PRO 6 143 18 Y 1 A LEU 7 ? A LEU 7 144 18 Y 1 A GLY 8 ? A GLY 8 145 19 Y 1 A THR 1 ? A THR 1 146 19 Y 1 A THR 2 ? A THR 2 147 19 Y 1 A LEU 3 ? A LEU 3 148 19 Y 1 A ASP 4 ? A ASP 4 149 19 Y 1 A ASP 5 ? A ASP 5 150 19 Y 1 A PRO 6 ? A PRO 6 151 19 Y 1 A LEU 7 ? A LEU 7 152 19 Y 1 A GLY 8 ? A GLY 8 153 20 Y 1 A THR 1 ? A THR 1 154 20 Y 1 A THR 2 ? A THR 2 155 20 Y 1 A LEU 3 ? A LEU 3 156 20 Y 1 A ASP 4 ? A ASP 4 157 20 Y 1 A ASP 5 ? A ASP 5 158 20 Y 1 A PRO 6 ? A PRO 6 159 20 Y 1 A LEU 7 ? A LEU 7 160 20 Y 1 A GLY 8 ? A GLY 8 #