data_2A63 # _entry.id 2A63 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2A63 pdb_00002a63 10.2210/pdb2a63/pdb RCSB RCSB033533 ? ? WWPDB D_1000033533 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2A63 _pdbx_database_status.recvd_initial_deposition_date 2005-07-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry N _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Newlove, T.' 1 'Atkinson, K.R.' 2 'Van Dorn, L.O.' 3 'Cordes, M.H.' 4 # _citation.id primary _citation.title 'A Trade between Similar but Nonequivalent Intrasubunit and Intersubunit Contacts in Cro Dimer Evolution.' _citation.journal_abbrev Biochemistry _citation.journal_volume 45 _citation.page_first 6379 _citation.page_last 6391 _citation.year 2006 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16700549 _citation.pdbx_database_id_DOI 10.1021/bi052541c # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Newlove, T.' 1 ? primary 'Atkinson, K.R.' 2 ? primary 'Van Dorn, L.O.' 3 ? primary 'Cordes, M.H.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Regulatory protein cro' _entity.formula_weight 7423.485 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'A33W, F58D, Y26Q' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MEQRITLKDYAMRFGQTKTAKDLGVQQSAINKWIHAGRKIFLTINADGSVYAEEVKPDPSNKKTTA _entity_poly.pdbx_seq_one_letter_code_can MEQRITLKDYAMRFGQTKTAKDLGVQQSAINKWIHAGRKIFLTINADGSVYAEEVKPDPSNKKTTA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLN n 1 4 ARG n 1 5 ILE n 1 6 THR n 1 7 LEU n 1 8 LYS n 1 9 ASP n 1 10 TYR n 1 11 ALA n 1 12 MET n 1 13 ARG n 1 14 PHE n 1 15 GLY n 1 16 GLN n 1 17 THR n 1 18 LYS n 1 19 THR n 1 20 ALA n 1 21 LYS n 1 22 ASP n 1 23 LEU n 1 24 GLY n 1 25 VAL n 1 26 GLN n 1 27 GLN n 1 28 SER n 1 29 ALA n 1 30 ILE n 1 31 ASN n 1 32 LYS n 1 33 TRP n 1 34 ILE n 1 35 HIS n 1 36 ALA n 1 37 GLY n 1 38 ARG n 1 39 LYS n 1 40 ILE n 1 41 PHE n 1 42 LEU n 1 43 THR n 1 44 ILE n 1 45 ASN n 1 46 ALA n 1 47 ASP n 1 48 GLY n 1 49 SER n 1 50 VAL n 1 51 TYR n 1 52 ALA n 1 53 GLU n 1 54 GLU n 1 55 VAL n 1 56 LYS n 1 57 PRO n 1 58 ASP n 1 59 PRO n 1 60 SER n 1 61 ASN n 1 62 LYS n 1 63 LYS n 1 64 THR n 1 65 THR n 1 66 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'Lambda-like viruses' _entity_src_gen.pdbx_gene_src_gene cro _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage lambda' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10710 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RCRO_LAMBD _struct_ref.pdbx_db_accession P03040 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2A63 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03040 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 66 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2A63 GLN A 26 ? UNP P03040 TYR 26 'engineered mutation' 26 1 1 2A63 TRP A 33 ? UNP P03040 ALA 33 'engineered mutation' 33 2 1 2A63 ASP A 58 ? UNP P03040 PHE 58 'engineered mutation' 58 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 2 2 1 HNHA 2 3 1 HNHB 2 4 1 'HSQC (amide hydrogen exchange)' 4 5 1 3D_13C-separated_NOESY 1 6 1 '2D NOESY' 3 7 2 '2D NOESY' 3 8 3 '2D NOESY' 3 9 1 '2D NOESY' 4 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 293 ambient 5.3 'no salt added' . K 2 293 ambient 6.1 'no salt added' . K 3 298 ambient 6.1 'no salt added' . K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2.5 mM lambda Cro A33W/F58D/Y26Q U-13C, 50mM Na-phosphate, 90% H2O, 10% D2O, 0.01% sodium azide, 1 mM TSP' '90% H2O/10% D2O' 2 '5 mM lambda Cro A33W/F58D/Y26Q U-15N, 50mM Na-phosphate, 90% H2O, 10% D2O, 0.01% sodium azide, 1 mM TSP' '90% H2O/10% D2O' 3 '5 mM lambda Cro A33W/F58D/Y26Q unlabelled, 50mM Na-phosphate, 90% H2O, 10% D2O, 0.01% sodium azide, 1 mM TSP' '90% H2O/10% D2O' 4 '5 mM lambda Cro A33W/F58D/Y26Q U-15N, 50mM Na-phosphate, 100% D2O, 0.01% sodium azide, 1 mM TSP' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2A63 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;40 structures were calculated using 838 noe-derived restraints, 14 hydrogen bond distance restraints, 50 phi angle restraints and 17 chi1 angle restraints. All 40 calculations converged to structures with no noe violations > 0.5 angstroms and no dihedral angle restraint violations >5 degrees. 14 of the 40 structures were discarded based on incompatibility of the rotamer of val 55 with a small J(HNHB) coupling constant, though no explicit restraint on the chi1 angle was included in the calculation. Of the 26 remaining structures, the 6 with the highest energy were discarded. In addition to having high energies, these 6 structures showed unusual conformations, particularly in turn regions, that were unreasonable and in strong disagreement with previously published structures of lambda Cro variants. The final ensemble contains 20 members. The ordered region of the protein extends from approximately residue 3 to residue 55. Pairwise RMSDs for the ordered region were 0.66 A (backbone atoms) and 1.29 A (all heavy atoms). None of the backbone angles in the ordered region of any ensemble member fell outside the most favorable and additionally allowed regions of a ramachandran plot. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2A63 _pdbx_nmr_details.text ;Proton chemical shifts submitted with this deposition were referenced to TSP at 0.00 ppm. However, we should add a cautionary note that this referencing led to an unusually high value for the water signal of 4.966 at 293 K, pH 5.3. We suspect that the TSP resonance is shifted below 0 ppm in our samples, possibly as much as -0.15 ppm. In our view, this is probably due to some transient interaction of the standard with the protein. ; # _pdbx_nmr_ensemble.entry_id 2A63 _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ;all structures compatible with experimental restraints; structures chosen had the lowest energies and/or best agreement to J(NHB) data not used in explicit restraints ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2A63 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.1 Bruker 1 processing NMRPipe 1.8 'Frank Delaglio, Stephan Grzesiek, Ad Bax, Guang Zhu, Geerten Vuister, John Pfeifer' 2 'data analysis' NMRView 4.1.3 'Bruce Johnston' 3 'structure solution' CNS 1.1 ? 4 refinement CNS 1.1 ? 5 # _exptl.entry_id 2A63 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2A63 _struct.title 'Solution structure of a stably monomeric mutant of lambda Cro produced by substitutions in the ball-and-socket interface' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2A63 _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'helix-turn-helix, monomer, ball-and-socket, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 7 ? PHE A 14 ? LEU A 7 PHE A 14 1 ? 8 HELX_P HELX_P2 2 GLY A 15 ? GLY A 24 ? GLY A 15 GLY A 24 1 ? 10 HELX_P HELX_P3 3 GLN A 26 ? ALA A 36 ? GLN A 26 ALA A 36 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 4 ? THR A 6 ? ARG A 4 THR A 6 A 2 ILE A 40 ? ILE A 44 ? ILE A 40 ILE A 44 A 3 VAL A 50 ? GLU A 54 ? VAL A 50 GLU A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 5 ? N ILE A 5 O LEU A 42 ? O LEU A 42 A 2 3 N PHE A 41 ? N PHE A 41 O GLU A 53 ? O GLU A 53 # _database_PDB_matrix.entry_id 2A63 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2A63 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ALA 66 66 66 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-06 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 57 ? ? -57.27 -161.69 2 2 GLU A 2 ? ? 60.62 87.26 3 2 GLN A 3 ? ? -97.82 39.01 4 2 LYS A 39 ? ? -68.23 76.41 5 2 LYS A 62 ? ? -79.98 -168.79 6 2 THR A 64 ? ? -101.85 53.54 7 3 PRO A 59 ? ? -55.08 87.82 8 3 THR A 65 ? ? -148.04 32.81 9 4 GLU A 2 ? ? 61.42 169.24 10 4 GLN A 3 ? ? -147.96 39.66 11 4 ARG A 13 ? ? -90.15 -69.07 12 4 LYS A 39 ? ? -66.04 87.84 13 4 PRO A 59 ? ? -65.31 65.15 14 4 SER A 60 ? ? 56.03 89.71 15 5 GLU A 2 ? ? 62.11 65.73 16 5 GLN A 3 ? ? -96.15 44.42 17 5 ARG A 13 ? ? -90.06 -72.49 18 5 PRO A 59 ? ? -68.32 67.57 19 5 LYS A 62 ? ? -105.89 -61.08 20 6 GLN A 3 ? ? -98.48 37.32 21 6 ARG A 13 ? ? -90.08 -63.84 22 6 PRO A 57 ? ? -71.95 -168.23 23 6 SER A 60 ? ? -176.71 -40.35 24 6 LYS A 63 ? ? -146.29 44.63 25 7 SER A 60 ? ? -155.25 -66.56 26 8 GLU A 2 ? ? -73.22 -169.79 27 8 ARG A 13 ? ? -84.66 -70.26 28 8 LYS A 56 ? ? -150.60 78.83 29 8 ASP A 58 ? ? 49.39 71.65 30 8 PRO A 59 ? ? -56.12 86.42 31 8 SER A 60 ? ? -162.73 86.53 32 8 LYS A 62 ? ? -133.13 -43.02 33 9 ASP A 58 ? ? -160.26 79.07 34 9 LYS A 62 ? ? -131.22 -67.81 35 10 ARG A 13 ? ? -90.09 -70.44 36 10 SER A 60 ? ? -157.78 31.22 37 10 LYS A 62 ? ? -144.17 37.38 38 10 THR A 65 ? ? -98.21 -66.44 39 11 GLU A 2 ? ? 62.63 118.97 40 11 ARG A 13 ? ? -90.06 -68.87 41 11 LYS A 39 ? ? -63.18 84.10 42 11 SER A 60 ? ? -170.56 78.03 43 11 LYS A 62 ? ? -158.44 -45.59 44 13 GLU A 2 ? ? 60.64 170.34 45 13 ARG A 13 ? ? -90.02 -70.19 46 13 PRO A 57 ? ? -73.16 -169.31 47 13 PRO A 59 ? ? -67.96 87.31 48 13 SER A 60 ? ? -90.19 54.18 49 14 GLN A 3 ? ? -156.97 37.23 50 14 ARG A 13 ? ? -90.04 -60.67 51 14 PRO A 59 ? ? -68.36 78.44 52 14 LYS A 62 ? ? -146.17 -48.13 53 15 PRO A 59 ? ? -60.02 -150.31 54 15 ASN A 61 ? ? -160.07 56.07 55 15 LYS A 63 ? ? -158.19 -46.04 56 16 GLN A 3 ? ? -152.30 39.55 57 16 PRO A 57 ? ? -69.76 -167.62 58 16 ASP A 58 ? ? -116.54 64.61 59 16 THR A 65 ? ? -150.19 -47.15 60 17 LYS A 39 ? ? -63.34 87.26 61 17 PRO A 59 ? ? -43.64 94.31 62 17 ASN A 61 ? ? -79.79 -166.34 63 17 THR A 65 ? ? -140.66 31.34 64 18 GLU A 2 ? ? -168.30 117.75 65 18 ARG A 13 ? ? -90.04 -70.02 66 18 SER A 60 ? ? -142.17 -58.10 67 18 LYS A 62 ? ? -143.34 -58.76 68 18 LYS A 63 ? ? -160.07 97.19 69 19 GLU A 2 ? ? -154.83 56.07 70 19 GLN A 3 ? ? -97.46 38.97 71 19 PRO A 59 ? ? -62.10 76.06 72 19 SER A 60 ? ? 52.65 83.70 73 20 GLN A 3 ? ? -159.22 36.78 74 20 ARG A 13 ? ? -90.06 -66.93 #