data_2BWH # _entry.id 2BWH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.299 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2BWH PDBE EBI-24901 WWPDB D_1290024901 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 101M unspecified 'SPERM WHALE MYOGLOBIN F46V N-BUTYL ISOCYANIDE AT PH 9.0' PDB 102M unspecified 'SPERM WHALE MYOGLOBIN H64A AQUOMET AT PH 9 .0' PDB 103M unspecified 'SPERM WHALE MYOGLOBIN H64A N-BUTYL ISOCYANIDE AT PH 9.0' PDB 104M unspecified 'SPERM WHALE MYOGLOBIN N-BUTYL ISOCYANIDE AT PH 7.0' PDB 105M unspecified 'SPERM WHALE MYOGLOBIN N-BUTYL ISOCYANIDE AT PH 9.0' PDB 106M unspecified 'SPERM WHALE MYOGLOBIN V68F ETHYL ISOCYANIDE AT PH 9.0' PDB 107M unspecified 'SPERM WHALE MYOGLOBIN V68F N-BUTYL ISOCYANIDE AT PH 9.0' PDB 108M unspecified 'SPERM WHALE MYOGLOBIN V68F N-BUTYL ISOCYANIDE AT PH 7.0' PDB 109M unspecified 'SPERM WHALE MYOGLOBIN D122N ETHYL ISOCYANIDE AT PH 9.0' PDB 110M unspecified 'SPERM WHALE MYOGLOBIN D122N METHYL ISOCYANIDE AT PH 9.0' PDB 111M unspecified 'SPERM WHALE MYOGLOBIN D112N N-BUTYL ISOCYANIDE AT PH 9.0' PDB 112M unspecified 'SPERM WHALE MYOGLOBIN D122N N-PROPYL ISOCYANIDE AT PH 9.0' PDB 1A6G unspecified 'CARBONMONOXY-MYOGLOBIN, ATOMIC RESOLUTION' PDB 1A6K unspecified 'AQUOMET-MYOGLOBIN, ATOMIC RESOLUTION' PDB 1A6M unspecified 'OXY-MYOGLOBIN, ATOMIC RESOLUTION' PDB 1A6N unspecified 'DEOXY-MYOGLOBIN, ATOMIC RESOLUTION' PDB 1ABS unspecified 'PHOTOLYSED CARBONMONOXY-MYOGLOBIN AT 20 K' PDB 1AJG unspecified 'CARBONMONOXY MYOGLOBIN AT 40 K' PDB 1AJH unspecified 'PHOTOPRODUCT OF CARBONMONOXY MYOGLOBIN AT 40 K' PDB 1BVC unspecified 'STRUCTURE OF A BILIVERDIN APOMYOGLOBIN COMPLEX (FORM D) AT 118 K' PDB 1BVD unspecified 'STRUCTURE OF A BILIVERDIN APOMYOGLOBIN COMPLEX (FORM B) AT 98 K' PDB 1BZ6 unspecified 'ATOMIC RESOLUTION CRYSTAL STRUCTURE AQUOMET- MYOGLOBIN FROM SPERM WHALE AT ROOM TEMPERATURE' PDB 1BZP unspecified 'ATOMIC RESOLUTION CRYSTAL STRUCTURE ANALYSIS OF NATIVE DEOXY AND CO MYOGLOBIN FROM SPERM WHALE AT ROOM TEMPERATURE' PDB 1BZR unspecified 'ATOMIC RESOLUTION CRYSTAL STRUCTURE ANALYSIS OF NATIVE DEOXY AND CO MYOGLOBIN FROM SPERM WHALE AT ROOM TEMPERATURE' PDB 1CH1 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN L89G MUTANT (MET)' PDB 1CH2 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN L89F MUTANT (MET)' PDB 1CH3 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN L89W MUTANT (MET)' PDB 1CH5 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN H97V MUTANT (MET)' PDB 1CH7 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN H97F MUTANT (MET)' PDB 1CH9 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN H97Q MUTANT (MET)' PDB 1CIK unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN I99A MUTANT (MET)' PDB 1CIO unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN I99V MUTANT (MET)' PDB 1CO8 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN L104A MUTANT (MET)' PDB 1CO9 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN L104V MUTANT (MET)' PDB 1CP0 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN L104N MUTANT (MET)' PDB 1CP5 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN L104F MUTANT (MET)' PDB 1CPW unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN L104W MUTANT (MET)' PDB 1CQ2 unspecified 'NEUTRON STRUTURE OF FULLY DEUTERATED SPERM WHALE MYOGLOBIN AT 2.0 ANGSTROM' PDB 1DO1 unspecified 'CARBONMONOXY-MYOGLOBIN MUTANT L29W AT 105K' PDB 1DO3 unspecified 'CARBONMONOXY-MYOGLOBIN (MUTANT L29W) AFTER PHOTOLYSIS AT T>180K' PDB 1DO4 unspecified 'CARBONMONOXY-MYOGLOBIN (MUTANT L29W) AFTER PHOTOLYSIS AT T<180K' PDB 1DO7 unspecified 'CARBONMONOXY-MYOGLOBIN (MUTANT L29W) REBINDING STRUCTURE AFTER PHOTOLYSIS AT T< 180K' PDB 1DTI unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN H97D, D122N MUTANT (MET)' PDB 1DTM unspecified 'CRYSTAL STRUCTURE OF THE SPERM-WHALE MYOGLOBIN MUTANT H93G COMPLEXED WITH 4- METHYLIMIDAZOLE, METAQUO FORM' PDB 1DUK unspecified 'WILD-TYPE RECOMBINANT SPERM WHALE METAQUOMYOGLOBIN' PDB 1DUO unspecified 'SPERM WHALE METAQUOMYOGLOBIN PROXIMAL HISTIDINE MUTANT H93G WITH 1-METHYLIMIDAZOLE AS PROXIMAL LIGAND.' PDB 1DXC unspecified 'CO COMPLEX OF MYOGLOBIN MB-YQR AT 100K' PDB 1DXD unspecified 'PHOTOLYZED CO COMPLEX OF MYOGLOBIN MB-YQR AT 20K' PDB 1EBC unspecified 'SPERM WHALE MET-MYOGLOBIN:CYANIDE COMPLEX' PDB 1F63 unspecified 'CRYSTAL STRUCTURE OF DEOXY SPERM WHALE MYOGLOBIN MUTANTY(B10)Q(E7)R(E10)' PDB 1F65 unspecified 'CRYSTAL STRUCTURE OF OXY SPERM WHALE MYOGLOBIN MUTANT Y(B10)Q(E7)R(E10)' PDB 1F6H unspecified 'COMBINED RIETVELD AND STEREOCHEMICAL RESTRAINT REFINEMENTOF A PROTEIN' PDB 1FCS unspecified 'MYOGLOBIN MUTANT WITH HIS 64 REPLACED BY VAL AND THR 67 REPLACED BY ARG (H64V, T67R)' PDB 1H1X unspecified 'SPERM WHALE MYOGLOBIN MUTANT T67R S92D' PDB 1HJT unspecified 'SPERM WHALE MYOGLOBIN (FERROUS, NITRIC OXIDE BOUND)' PDB 1IOP unspecified 'INCORPORATION OF A HEMIN WITH THE SHORTEST ACID SIDE-CHAINS INTO MYOGLOBIN' PDB 1IRC unspecified 'CYSTEINE RICH INTESTINAL PROTEIN' PDB 1J3F unspecified ;CRYSTAL STRUCTURE OF AN ARTIFICIAL METALLOPROTEIN:CR(III)(3,3'-ME2-SALOPHEN)/ APO-A71G MYOGLOBIN ; PDB 1J52 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN IN THE PRESENCE OF 7ATMXENON' PDB 1JDO unspecified 'SPERM WHALE MYOGLOBIN (FERROUS, NITRIC OXIDE BOUND)' PDB 1JP6 unspecified 'SPERM WHALE MET-MYOGLOBIN (ROOM TEMPERATURE; ROOM PRESSURE)' PDB 1JP8 unspecified 'SPERM WHALE MET-MYOGLOBIN (ROOM TEMPERATURE; HIGH PRESSURE)' PDB 1JP9 unspecified 'SPERM WHALE MET-MYOGLOBIN (LOW TEMPERATURE; HIGH PRESSURE)' PDB 1JPB unspecified 'SPERM WHALE MET-MYOGLOBIN (LOW TEMPERATURE; HIGH PRESSURE)' PDB 1JW8 unspecified '1.3 ANGSTROM RESOLUTION CRYSTAL STRUCTURE OF P6 FORM OFMYOGLOBIN' PDB 1L2K unspecified 'NEUTRON STRUCTURE DETERMINATION OF SPERM WHALE MET-MYOGLOBIN AT 1.5A RESOLUTION.' PDB 1LTW unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN 29W MUTANT (OXY)' PDB 1LUE unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN H64D/V68A/ D122N MUTANT(MET)' PDB 1MBC unspecified 'MYOGLOBIN (FE II, CARBONMONOXY, 260 DEGREES K)' PDB 1MBD unspecified 'MYOGLOBIN (DEOXY, PH 8.4)' PDB 1MBI unspecified 'MYOGLOBIN (FERRIC) COMPLEX WITH IMIDAZOLE' PDB 1MBN unspecified 'MYOGLOBIN (FERRIC IRON - METMYOGLOBIN)' PDB 1MBO unspecified 'MYOGLOBIN (OXY, PH 8.4)' PDB 1MCY unspecified 'SPERM WHALE MYOGLOBIN (MUTANT WITH INITIATOR MET AND WITH HIS 64 REPLACED BY GLN, LEU 29 REPLACED BY PHE' PDB 1MGN unspecified 'METMYOGLOBIN MUTANT WITH INITIATOR MET, ASP 122 REPLACED BY ASN, AND HIS 64 REPLACED BY TYR (INS(M-V1),D122N,H64Y)' PDB 1MLF unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY ALA, ASP 122 REPLACED BY ASN (M0,V68A,D122N)' PDB 1MLG unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY ALA, ASP 122 REPLACED BY ASN (M0,V68A,D122N)' PDB 1MLH unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY ALA, ASP 122 REPLACED BY ASN (M0,V68A,D122N)' PDB 1MLJ unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY PHE, ASP 122 REPLACED BY ASN (M0,V68F,D122N)' PDB 1MLK unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY PHE, ASP 122 REPLACED BY ASN (M0,V68F,D122N)' PDB 1MLL unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY PHE, ASP 122 REPLACED BY ASN (M0,V68F,D122N)' PDB 1MLM unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY ILE, ASP 122 REPLACED BY ASN (M0,V68I,D122N)' PDB 1MLN unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY ILE, ASP 122 REPLACED BY ASN (M0,V68I,D122N)' PDB 1MLO unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY ILE, ASP 122 REPLACED BY ASN (M0,V68I,D122N)' PDB 1MLQ unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY LEU, ASP 122 REPLACED BY ASN (INS(M0),V68L,D122N)' PDB 1MLR unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY LEU, ASP 122 REPLACED BY ASN (M0,V68L,D122N)' PDB 1MLS unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, VAL 68 REPLACED BY LEU, ASP 122 REPLACED BY ASN (M0,V68L,D122N)' PDB 1MLU unspecified ;MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, HIS 64 REPLACED BY GLY, VAL 68 REPLACED BY ALA, ASP 122 REPLACED BY ASN (M0,H64G,V68A,D122N) ; PDB 1MOA unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET, LEU 29 REPLACED BY PHE, ASP 122 REPLACED BY ASN (INS(M0),L29F,D122N)' PDB 1MOB unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET, HIS 64 REPLACED BY GLY, ASP 122 REPLACED BY ASN (INS(M0,H64G,D122N)' PDB 1MOC unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, HIS 64 REPLACED BY THR, ASP 122 REPLACED BY ASN (INS(M0),H64T,D122N)' PDB 1MOD unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET, HIS 64 REPLACED BY THR, ASP 122 REPLACED BY ASN (INS(M0),H64T,D122N)' PDB 1MTI unspecified ;MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: NULL; ENGINEERED: YES; MUTATION: INITIATOR MET, PHE 46 REPLACED BY LEU AND ASP 122 REPLACED BY ASN (INS(MET 0), F46L, D122N); OTHER_DETAILS: FERRIC ; PDB 1MTJ unspecified ;MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: NULL; ENGINEERED: YES; MUTATION: INITIATOR MET, PHE 46 REPLACED BY VAL AND ASP 122 REPLACED BY ASN (INS(MET 0), F46V, D122N); OTHER_DETAILS: DEOXY ; PDB 1MTK unspecified ;MOL_ID: 1; MOLECULE: MYOGLOBIN; CHAIN: NULL; ENGINEERED: YES; MUTATION: INITIATOR MET, PHE 46 REPLACED BY VAL AND ASP 122 REPLACED BY ASN (INS(MET 0), F46V, D122N); OTHER_DETAILS: FERRIC ; PDB 1MYF unspecified 'MYOGLOBIN (FE II, CARBONMONOXY) (NMR, 12 STRUCTURES)' PDB 1MYM unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, ASP 122 REPLACED BY ASN, AND PHE 46 REPLACED BY VAL (INS(M-V1),D122N,F46V)' PDB 1MYZ unspecified 'CO COMPLEX OF MYOGLOBIN MB-YQR AT RT SOLVED FROM LAUE DATA.' PDB 1MZ0 unspecified 'STRUCTURE OF MYOGLOBIN MB-YQR 316 NS AFTER PHOTOLYSIS OFCARBON MONOXIDE SOLVED FROM LAUE DATA AT RT.' PDB 1N9F unspecified 'STRUCTURE OF EARTH-GROWN OXIDIZED MYOGLOBIN MUTANT YQR(ISS6A)' PDB 1N9H unspecified 'STRUCTURE OF MICROGRAVITY-GROWN OXIDIZED MYOGLOBIN MUTANTYQR (ISS6A)' PDB 1N9I unspecified 'STRUCTURE OF EARTH-GROWN OXIDIZED MYOGLOBIN MUTANT YQR(ISS8A)' PDB 1N9X unspecified 'STRUCTURE OF MICROGRAVITY-GROWN OXIDIZED MYOGLOBIN MUTANTYQR (ISS8A)' PDB 1NAZ unspecified 'STRUCTURE OF MICROGRAVITY-GROWN OXIDIZED MYOGLOBIN MUTANTYQR (ISS8A)' PDB 1O16 unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN H64D/V68S/ D122N MUTANT(MET)' PDB 1OBM unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN 29F/64Q/ 68F/122N MUTANT (MET)' PDB 1OFJ unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN L29H/H64L/ D122N MUTANT (WITH INITIATOR MET)' PDB 1OFK unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN F43H, H64L MUTANT (MET)' PDB 1SPE unspecified 'SPERM WHALE NATIVE CO MYOGLOBIN AT PH 4. 0, TEMP 4C' PDB 1SWM unspecified 'MYOGLOBIN (FERRIC) COMPLEXED WITH AZIDE' PDB 1TES unspecified 'OXYGEN BINDING MUSCLE PROTEIN' PDB 1UFJ unspecified ;CRYSTAL STRUCTURE OF AN ARTIFICIAL METALLOPROTEIN:FE(III)(3,3'-ME2-SALOPHEN)/ APO-A71G MYOGLOBIN ; PDB 1UFP unspecified ;CRYSTAL STRUCTURE OF AN ARTIFICIAL METALLOPROTEIN:FE(III)(3,3'-ME2-SALOPHEN)/ APO-WILD TYPE MYOGLOBIN ; PDB 1VXA unspecified 'NATIVE SPERM WHALE MYOGLOBIN' PDB 1VXB unspecified 'NATIVE SPERM WHALE MYOGLOBIN' PDB 1VXC unspecified 'NATIVE SPERM WHALE MYOGLOBIN' PDB 1VXD unspecified 'NATIVE SPERM WHALE MYOGLOBIN' PDB 1VXE unspecified 'NATIVE SPERM WHALE MYOGLOBIN' PDB 1VXF unspecified 'NATIVE SPERM WHALE MYOGLOBIN' PDB 1VXG unspecified 'NATIVE SPERM WHALE MYOGLOBIN' PDB 1VXH unspecified 'NATIVE SPERM WHALE MYOGLOBIN' PDB 1WVP unspecified 'STRUCTURE OF CHEMICALLY MODIFIED MYOGLOBIN WITH DISTAL N-TETRAZOLYL-HISTIDINE E7(64)' PDB 1YOG unspecified 'COBALT MYOGLOBIN (DEOXY)' PDB 1YOH unspecified 'COBALT MYOGLOBIN (MET)' PDB 1YOI unspecified 'COBALT MYOGLOBIN (OXY)' PDB 2BLH unspecified 'LIGAND MIGRATION AND PROTEIN FLUCTUATIONS IN MYOGLOBIN MUTANT L29W' PDB 2BLI unspecified 'L29W MB DEOXY' PDB 2BLJ unspecified 'STRUCTURE OF L29W MBCO' PDB 2BW9 unspecified 'LAUE STRUCTURE OF L29W MBCO' PDB 2CMM unspecified 'MYOGLOBIN (CYANO,MET) RECONSTITUTED WITH IRON (III) COMPLEXES OF PORPHYRIN' PDB 2MB5 unspecified 'MYOGLOBIN (CARBONMONOXYMYOGLOBIN) (NEUTRON STUDY)' PDB 2MBW unspecified 'RECOMBINANT SPERM WHALE MYOGLOBIN (MET)' PDB 2MGA unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, HIS 64 REPLACED BY GLY, AND ASP 122 REPLACED BY ASN (MET,H64G,D122N)' PDB 2MGB unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, HIS 64 REPLACED BY GLY, AND ASP 122 REPLACED BY ASN (MET,H64G,D122N)' PDB 2MGC unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, HIS 64 REPLACED BY LEU, AND ASP 122 REPLACED BY ASN (MET,H64L,D122N)' PDB 2MGD unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET, ASP 122 REPLACED BY ASN, AND HIS 64 REPLACED BY LEU (MET,D122N,H64L)' PDB 2MGE unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, ASP 122 REPLACED BY ASN, AND HIS 64 REPLACED BY LEU (MET,D122N,H64L)' PDB 2MGF unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, ASP 122 REPLACED BY ASN, AND HIS 64 REPLACED BY GLN (MET,D122N,H64Q)' PDB 2MGG unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET AND WITH ASP 122 REPLACED BY ASN AND HIS 64 REPLACED BY GLN (INS(M-V1,D122N, H64Q)' PDB 2MGH unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, HIS 64 REPLACED BY GLN, AND ASP 122 REPLACED BY ASN (MET,H64Q,D122N)' PDB 2MGI unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, ASP 122 REPLACED BY ASN, AND HIS 64 REPLACED BY THR (MET,D122N,H64T)' PDB 2MGJ unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, ASP 122 REPLACED BY ASN, AND HIS 64 REPLACED BY VAL (MET,D122N,H64V)' PDB 2MGK unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET AND ASP 122 REPLACED BY ASN (MET, D122N)' PDB 2MGL unspecified 'MYOGLOBIN (DEOXY) MUTANT WITH INITIATOR MET AND ASP 122 REPLACED BY ASN (MET,D122N)' PDB 2MGM unspecified 'MYOGLOBIN (OXY) MUTANT WITH INITIATOR MET AND ASP 122 REPLACED BY ASN (MET,D122N)' PDB 2MYA unspecified 'MYOGLOBIN (ETHYL ISOCYANIDE, PH 7.0)' PDB 2MYB unspecified 'MYOGLOBIN (METHYL ISOCYANIDE, PH 7.0)' PDB 2MYC unspecified 'MYOGLOBIN (N-BUTYL ISOCYANIDE, PH 7.0)' PDB 2MYD unspecified 'MYOGLOBIN (N-PROPYL ISOCYANIDE, PH 7.0)' PDB 2MYE unspecified 'MYOGLOBIN (ETHYL ISOCYANIDE, PH <<7.0)' PDB 2SPL unspecified 'MYOGLOBIN (CARBONMONOXY) MUTANT WITH INITIATOR MET, ASP 122 REPLACED BY ASN, AND LEU 29 REPLACED BY PHE (MET,D122N,L29F)' PDB 2SPM unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, ASP 122 REPLACED BY ASN, AND LEU 29 REPLACED BY PHE (MET,D122N,L29F)' PDB 2SPN unspecified 'MYOGLOBIN (OXY) MUTANT WITH INITIATOR MET, LEU 29 REPLACED BY PHE, AND ASP 122 REPLACED BY ASN (MET,L29F,D122N)' PDB 2SPO unspecified 'MYOGLOBIN (MET) MUTANT WITH INITIATOR MET, LEU 29 REPLACED BY VAL, AND ASP 122 REPLACED BY ASN (MET,L29V,D122N)' PDB 4MBN unspecified 'MYOGLOBIN (MET)' PDB 5MBN unspecified 'MYOGLOBIN (DEOXY)' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2BWH _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2005-07-14 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schmidt, M.' 1 'Nienhaus, K.' 2 'Pahl, R.' 3 'Krasselt, A.' 4 'Anderson, S.' 5 'Parak, F.' 6 'Nienhaus, G.U.' 7 'Srajer, V.' 8 # _citation.id primary _citation.title 'Ligand migration pathway and protein dynamics in myoglobin: a time-resolved crystallographic study on L29W MbCO.' _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_volume 102 _citation.page_first 11704 _citation.page_last 11709 _citation.year 2005 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16085709 _citation.pdbx_database_id_DOI 10.1073/pnas.0504932102 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schmidt, M.' 1 ? primary 'Nienhaus, K.' 2 ? primary 'Pahl, R.' 3 ? primary 'Krasselt, A.' 4 ? primary 'Anderson, S.' 5 ? primary 'Parak, F.' 6 ? primary 'Nienhaus, G.U.' 7 ? primary 'Srajer, V.' 8 ? # _cell.entry_id 2BWH _cell.length_a 91.870 _cell.length_b 91.870 _cell.length_c 46.040 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2BWH _symmetry.space_group_name_H-M 'P 6' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 168 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Myoglobin 17307.020 1 ? L29W ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn 'CARBON MONOXIDE' 28.010 1 ? ? ? ? 4 water nat water 18.015 101 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_seq_one_letter_code_can ;VLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LEU n 1 3 SER n 1 4 GLU n 1 5 GLY n 1 6 GLU n 1 7 TRP n 1 8 GLN n 1 9 LEU n 1 10 VAL n 1 11 LEU n 1 12 HIS n 1 13 VAL n 1 14 TRP n 1 15 ALA n 1 16 LYS n 1 17 VAL n 1 18 GLU n 1 19 ALA n 1 20 ASP n 1 21 VAL n 1 22 ALA n 1 23 GLY n 1 24 HIS n 1 25 GLY n 1 26 GLN n 1 27 ASP n 1 28 ILE n 1 29 TRP n 1 30 ILE n 1 31 ARG n 1 32 LEU n 1 33 PHE n 1 34 LYS n 1 35 SER n 1 36 HIS n 1 37 PRO n 1 38 GLU n 1 39 THR n 1 40 LEU n 1 41 GLU n 1 42 LYS n 1 43 PHE n 1 44 ASP n 1 45 ARG n 1 46 PHE n 1 47 LYS n 1 48 HIS n 1 49 LEU n 1 50 LYS n 1 51 THR n 1 52 GLU n 1 53 ALA n 1 54 GLU n 1 55 MET n 1 56 LYS n 1 57 ALA n 1 58 SER n 1 59 GLU n 1 60 ASP n 1 61 LEU n 1 62 LYS n 1 63 LYS n 1 64 HIS n 1 65 GLY n 1 66 VAL n 1 67 THR n 1 68 VAL n 1 69 LEU n 1 70 THR n 1 71 ALA n 1 72 LEU n 1 73 GLY n 1 74 ALA n 1 75 ILE n 1 76 LEU n 1 77 LYS n 1 78 LYS n 1 79 LYS n 1 80 GLY n 1 81 HIS n 1 82 HIS n 1 83 GLU n 1 84 ALA n 1 85 GLU n 1 86 LEU n 1 87 LYS n 1 88 PRO n 1 89 LEU n 1 90 ALA n 1 91 GLN n 1 92 SER n 1 93 HIS n 1 94 ALA n 1 95 THR n 1 96 LYS n 1 97 HIS n 1 98 LYS n 1 99 ILE n 1 100 PRO n 1 101 ILE n 1 102 LYS n 1 103 TYR n 1 104 LEU n 1 105 GLU n 1 106 PHE n 1 107 ILE n 1 108 SER n 1 109 GLU n 1 110 ALA n 1 111 ILE n 1 112 ILE n 1 113 HIS n 1 114 VAL n 1 115 LEU n 1 116 HIS n 1 117 SER n 1 118 ARG n 1 119 HIS n 1 120 PRO n 1 121 GLY n 1 122 ASN n 1 123 PHE n 1 124 GLY n 1 125 ALA n 1 126 ASP n 1 127 ALA n 1 128 GLN n 1 129 GLY n 1 130 ALA n 1 131 MET n 1 132 ASN n 1 133 LYS n 1 134 ALA n 1 135 LEU n 1 136 GLU n 1 137 LEU n 1 138 PHE n 1 139 ARG n 1 140 LYS n 1 141 ASP n 1 142 ILE n 1 143 ALA n 1 144 ALA n 1 145 LYS n 1 146 TYR n 1 147 LYS n 1 148 GLU n 1 149 LEU n 1 150 GLY n 1 151 TYR n 1 152 GLN n 1 153 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 153 _entity_src_gen.gene_src_common_name 'Sperm whale' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Physeter catodon' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9755 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG_PHYCD _struct_ref.pdbx_db_accession P02185 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2BWH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02185 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 154 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2BWH TRP A 29 ? UNP P02185 LEU 30 conflict 29 1 1 2BWH ASN A 122 ? UNP P02185 ASP 123 conflict 122 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CMO non-polymer . 'CARBON MONOXIDE' ? 'C O' 28.010 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2BWH _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 5 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.24 _exptl_crystal.density_percent_sol 57.2 _exptl_crystal.description ;EXTRAPOLATED STRUCTURE FACTORS FROM ADDING AVERAGED DIFFERENCE STRUCTURE FACTORS TO STRUCTURE FACTORS CALCULATED FROM THE DARK STATE L29W MODEL. AVERAGED DIFFERENCE STRUCTURE FACTORS WERE CALCULATED BY FOURIER INVERSION OF AN AVERAGE OF 6 DIFFERENCE ELECTRON DENSITY MAPS IN THE TIME-RANGE 1 MICRO- SEC TO 100 MICRO-SEC. ; _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.80 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.80' # _diffrn.id 1 _diffrn.ambient_temp 288.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2003-12-20 _diffrn_detector.details MIRROR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 14-ID-B' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 14-ID-B _diffrn_source.pdbx_wavelength 1.0 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2BWH _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 15.000 _reflns.d_resolution_high 1.900 _reflns.number_obs 17619 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.94 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2BWH _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 17619 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 10000 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 15 _refine.ls_d_res_high 1.9 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.2299 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2299 _refine.ls_R_factor_R_free 0.2325 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 857 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 22.1 _refine.aniso_B[1][1] 0.027 _refine.aniso_B[2][2] 0.027 _refine.aniso_B[3][3] -0.054 _refine.aniso_B[1][2] -4.876 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'FLAT MODEL DENSITY' _refine.solvent_model_param_ksol 1.56593 _refine.solvent_model_param_bsol 300 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 2BWH _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs 1.8 _refine_analyze.Luzzati_d_res_low_obs 5 _refine_analyze.Luzzati_coordinate_error_free 0.25 _refine_analyze.Luzzati_sigma_a_free 0.2 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1223 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.number_atoms_solvent 101 _refine_hist.number_atoms_total 1369 _refine_hist.d_res_high 1.9 _refine_hist.d_res_low 15 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.0067 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 0.97 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 17.3 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.04 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 17 _refine_ls_shell.d_res_high 1.9 _refine_ls_shell.d_res_low 1.94 _refine_ls_shell.number_reflns_R_work 1101 _refine_ls_shell.R_factor_R_work 0.282 _refine_ls_shell.percent_reflns_obs 100 _refine_ls_shell.R_factor_R_free 0.308 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5.2 _refine_ls_shell.number_reflns_R_free 60 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 PARAM19X.HEME TOPH19XAO.HEME # _struct.entry_id 2BWH _struct.title 'Laue Structure of a Short Lived State of L29W Myoglobin' _struct.pdbx_descriptor MYOGLOBIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2BWH _struct_keywords.pdbx_keywords 'OXYGEN TRANSPORT' _struct_keywords.text 'LAUE CRYSTALLOGRAPHY, L29W MYOGLOBIN, TIME-RESOLVED X-RAY STRUCTURE DETERMINATION, OXYGEN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? GLU A 18 ? SER A 3 GLU A 18 1 ? 16 HELX_P HELX_P2 2 ASP A 20 ? HIS A 36 ? ASP A 20 HIS A 36 1 ? 17 HELX_P HELX_P3 3 PRO A 37 ? PHE A 43 ? PRO A 37 PHE A 43 5 ? 7 HELX_P HELX_P4 4 THR A 51 ? SER A 58 ? THR A 51 SER A 58 1 ? 8 HELX_P HELX_P5 5 SER A 58 ? LYS A 77 ? SER A 58 LYS A 77 1 ? 20 HELX_P HELX_P6 6 HIS A 82 ? LYS A 96 ? HIS A 82 LYS A 96 1 ? 15 HELX_P HELX_P7 7 PRO A 100 ? HIS A 119 ? PRO A 100 HIS A 119 1 ? 20 HELX_P HELX_P8 8 PRO A 120 ? PHE A 123 ? PRO A 120 PHE A 123 5 ? 4 HELX_P HELX_P9 9 GLY A 124 ? GLY A 150 ? GLY A 124 GLY A 150 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id HEM _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id FE _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id HIS _struct_conn.ptnr2_label_seq_id 93 _struct_conn.ptnr2_label_atom_id NE2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id HEM _struct_conn.ptnr1_auth_seq_id 1154 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id HIS _struct_conn.ptnr2_auth_seq_id 93 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.233 _struct_conn.pdbx_value_order ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE HEM A1154' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CMO A1155' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 TRP A 29 ? TRP A 29 . ? 1_555 ? 2 AC1 13 PHE A 43 ? PHE A 43 . ? 1_555 ? 3 AC1 13 ARG A 45 ? ARG A 45 . ? 1_555 ? 4 AC1 13 HIS A 64 ? HIS A 64 . ? 1_555 ? 5 AC1 13 LEU A 89 ? LEU A 89 . ? 1_555 ? 6 AC1 13 SER A 92 ? SER A 92 . ? 1_555 ? 7 AC1 13 HIS A 93 ? HIS A 93 . ? 1_555 ? 8 AC1 13 HIS A 97 ? HIS A 97 . ? 1_555 ? 9 AC1 13 ILE A 99 ? ILE A 99 . ? 1_555 ? 10 AC1 13 TYR A 103 ? TYR A 103 . ? 1_555 ? 11 AC1 13 CMO C . ? CMO A 1155 . ? 1_555 ? 12 AC1 13 HOH D . ? HOH A 2099 . ? 1_555 ? 13 AC1 13 HOH D . ? HOH A 2101 . ? 1_555 ? 14 AC2 4 LEU A 89 ? LEU A 89 . ? 1_555 ? 15 AC2 4 HIS A 93 ? HIS A 93 . ? 1_555 ? 16 AC2 4 PHE A 138 ? PHE A 138 . ? 1_555 ? 17 AC2 4 HEM B . ? HEM A 1154 . ? 1_555 ? # _database_PDB_matrix.entry_id 2BWH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2BWH _atom_sites.fract_transf_matrix[1][1] 0.010885 _atom_sites.fract_transf_matrix[1][2] 0.006284 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012569 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021720 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLY 153 153 153 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 1154 1154 HEM HEM A . C 3 CMO 1 1155 1155 CMO CMO A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 NA ? B HEM . ? A HEM 1154 ? 1_555 94.7 ? 2 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 NB ? B HEM . ? A HEM 1154 ? 1_555 98.7 ? 3 NA ? B HEM . ? A HEM 1154 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 NB ? B HEM . ? A HEM 1154 ? 1_555 92.0 ? 4 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 NC ? B HEM . ? A HEM 1154 ? 1_555 103.5 ? 5 NA ? B HEM . ? A HEM 1154 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 NC ? B HEM . ? A HEM 1154 ? 1_555 160.5 ? 6 NB ? B HEM . ? A HEM 1154 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 NC ? B HEM . ? A HEM 1154 ? 1_555 91.8 ? 7 NE2 ? A HIS 93 ? A HIS 93 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 ND ? B HEM . ? A HEM 1154 ? 1_555 98.2 ? 8 NA ? B HEM . ? A HEM 1154 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 ND ? B HEM . ? A HEM 1154 ? 1_555 85.7 ? 9 NB ? B HEM . ? A HEM 1154 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 ND ? B HEM . ? A HEM 1154 ? 1_555 163.0 ? 10 NC ? B HEM . ? A HEM 1154 ? 1_555 FE ? B HEM . ? A HEM 1154 ? 1_555 ND ? B HEM . ? A HEM 1154 ? 1_555 85.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-07-28 2 'Structure model' 1 1 2018-12-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Refinement description' 4 2 'Structure model' 'Source and taxonomy' 5 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' diffrn_radiation 3 2 'Structure model' entity 4 2 'Structure model' entity_src_gen 5 2 'Structure model' pdbx_entity_src_syn 6 2 'Structure model' software 7 2 'Structure model' struct_ref 8 2 'Structure model' struct_ref_seq 9 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.page_last' 3 2 'Structure model' '_citation.pdbx_database_id_DOI' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_diffrn_radiation.pdbx_diffrn_protocol' 6 2 'Structure model' '_diffrn_radiation.pdbx_monochromatic_or_laue_m_l' 7 2 'Structure model' '_entity.pdbx_description' 8 2 'Structure model' '_entity.pdbx_mutation' 9 2 'Structure model' '_entity.src_method' 10 2 'Structure model' '_software.name' 11 2 'Structure model' '_struct_ref.db_code' 12 2 'Structure model' '_struct_ref.pdbx_align_begin' 13 2 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 14 2 'Structure model' '_struct_ref_seq.db_align_beg' 15 2 'Structure model' '_struct_ref_seq.db_align_end' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language CNS refinement 1.1 ? 1 ? ? ? ? Precognition 'data reduction' . ? 2 ? ? ? ? LaueView 'data reduction' . ? 3 ? ? ? ? Epinorm 'data scaling' . ? 4 ? ? ? ? LaueView 'data scaling' . ? 5 ? ? ? ? # _pdbx_entry_details.entry_id 2BWH _pdbx_entry_details.compound_details 'ENGINEERED RESIDUE IN CHAIN M, LEU 29 TO TRP' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? -159.07 71.61 2 1 LYS A 96 ? ? -97.55 -61.48 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 'CARBON MONOXIDE' CMO 4 water HOH #