data_2CR8 # _entry.id 2CR8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CR8 pdb_00002cr8 10.2210/pdb2cr8/pdb RCSB RCSB024535 ? ? WWPDB D_1000024535 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001003497.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CR8 _pdbx_database_status.recvd_initial_deposition_date 2005-05-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the zf-RanBP domain of p53-binding protein Mdm4' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mdm4 protein' 5967.539 1 ? ? 'zf-RanBP domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'p53-binding protein Mdm4, Mdm2-like p53-binding protein, Mdmx protein, Double minute 4 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001003497.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 GLU n 1 10 ASP n 1 11 GLU n 1 12 TRP n 1 13 GLN n 1 14 CYS n 1 15 THR n 1 16 GLU n 1 17 CYS n 1 18 LYS n 1 19 LYS n 1 20 PHE n 1 21 ASN n 1 22 SER n 1 23 PRO n 1 24 SER n 1 25 LYS n 1 26 ARG n 1 27 TYR n 1 28 CYS n 1 29 PHE n 1 30 ARG n 1 31 CYS n 1 32 TRP n 1 33 ALA n 1 34 LEU n 1 35 ARG n 1 36 LYS n 1 37 ASP n 1 38 TRP n 1 39 TYR n 1 40 SER n 1 41 ASP n 1 42 CYS n 1 43 SER n 1 44 LYS n 1 45 LEU n 1 46 THR n 1 47 HIS n 1 48 SER n 1 49 GLY n 1 50 PRO n 1 51 SER n 1 52 SER n 1 53 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene MDM4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040809-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MDM4_HUMAN _struct_ref.pdbx_db_accession O15151 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTH _struct_ref.pdbx_align_begin 300 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CR8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 47 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15151 _struct_ref_seq.db_align_beg 300 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 339 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 47 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CR8 GLY A 1 ? UNP O15151 ? ? 'cloning artifact' 1 1 1 2CR8 SER A 2 ? UNP O15151 ? ? 'cloning artifact' 2 2 1 2CR8 SER A 3 ? UNP O15151 ? ? 'cloning artifact' 3 3 1 2CR8 GLY A 4 ? UNP O15151 ? ? 'cloning artifact' 4 4 1 2CR8 SER A 5 ? UNP O15151 ? ? 'cloning artifact' 5 5 1 2CR8 SER A 6 ? UNP O15151 ? ? 'cloning artifact' 6 6 1 2CR8 GLY A 7 ? UNP O15151 ? ? 'cloning artifact' 7 7 1 2CR8 SER A 48 ? UNP O15151 ? ? 'cloning artifact' 48 8 1 2CR8 GLY A 49 ? UNP O15151 ? ? 'cloning artifact' 49 9 1 2CR8 PRO A 50 ? UNP O15151 ? ? 'cloning artifact' 50 10 1 2CR8 SER A 51 ? UNP O15151 ? ? 'cloning artifact' 51 11 1 2CR8 SER A 52 ? UNP O15151 ? ? 'cloning artifact' 52 12 1 2CR8 GLY A 53 ? UNP O15151 ? ? 'cloning artifact' 53 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.42mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH7.0); 200mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.01mM ZnCl2' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CR8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CR8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CR8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.04 Johnson,B.A. 3 'data analysis' KUJIRA 0.9296 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 2CR8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CR8 _struct.title 'Solution structure of the zf-RanBP domain of p53-binding protein Mdm4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CR8 _struct_keywords.pdbx_keywords 'CELL CYCLE' _struct_keywords.text ;zf-RanBP domain; Mdm4 protein; p53-binding protein Mdm4; Mdm2-like p53-binding DE protein; Mdmx protein; Double minute 4 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL CYCLE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 401 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 401 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc3 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 401 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc4 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 401 1_555 ? ? ? ? ? ? ? 2.248 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 2 AC1 4 CYS A 17 ? CYS A 17 . ? 1_555 ? 3 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 4 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CR8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CR8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLY 53 53 53 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 401 _pdbx_nonpoly_scheme.auth_seq_num 401 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 111.9 ? 2 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 102.1 ? 3 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 106.1 ? 4 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 105.0 ? 5 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 117.2 ? 6 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 113.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? 35.43 42.32 2 1 GLU A 9 ? ? -109.06 40.50 3 1 ASP A 10 ? ? -106.36 40.74 4 1 CYS A 42 ? ? -130.52 -50.68 5 1 PRO A 50 ? ? -69.71 -174.27 6 2 TRP A 32 ? ? 34.03 52.44 7 2 ARG A 35 ? ? -44.25 167.81 8 3 SER A 6 ? ? -36.10 148.49 9 3 CYS A 28 ? ? -33.19 116.82 10 3 PHE A 29 ? ? -82.17 40.05 11 3 ARG A 30 ? ? -134.60 -40.66 12 3 ARG A 35 ? ? -54.13 -75.32 13 3 ASP A 37 ? ? -86.62 42.03 14 3 LEU A 45 ? ? -38.58 111.82 15 3 SER A 51 ? ? -128.34 -50.29 16 3 SER A 52 ? ? 39.88 41.80 17 4 SER A 8 ? ? -65.65 94.83 18 4 LYS A 18 ? ? 38.94 28.38 19 4 ARG A 26 ? ? -121.04 -63.81 20 4 TRP A 32 ? ? 34.00 54.62 21 4 LYS A 44 ? ? -96.57 41.24 22 4 SER A 52 ? ? -133.74 -49.41 23 5 PRO A 23 ? ? -69.79 2.72 24 5 TRP A 32 ? ? 34.38 41.55 25 5 SER A 43 ? ? -37.01 137.54 26 5 SER A 48 ? ? -174.41 149.07 27 5 SER A 52 ? ? 37.17 41.95 28 6 SER A 8 ? ? -170.22 139.78 29 6 GLU A 9 ? ? -37.19 153.58 30 6 LYS A 18 ? ? 40.52 26.65 31 6 PRO A 23 ? ? -69.72 5.88 32 6 ARG A 30 ? ? -133.41 -33.71 33 6 TRP A 32 ? ? 37.16 48.38 34 6 ASP A 37 ? ? -35.82 121.54 35 7 SER A 6 ? ? 70.74 43.29 36 7 ASP A 10 ? ? -82.64 43.77 37 7 LYS A 18 ? ? 40.07 26.99 38 7 ARG A 30 ? ? -134.87 -35.34 39 7 TRP A 32 ? ? 34.75 49.37 40 7 LEU A 34 ? ? -43.47 155.34 41 8 SER A 2 ? ? -98.38 42.16 42 8 PRO A 23 ? ? -69.70 2.81 43 8 TRP A 32 ? ? 31.72 38.80 44 8 ARG A 35 ? ? -81.63 43.62 45 9 GLU A 16 ? ? -128.81 -52.12 46 9 ARG A 30 ? ? -134.66 -35.33 47 9 TRP A 32 ? ? 33.69 48.74 48 9 ARG A 35 ? ? -33.96 102.05 49 9 PRO A 50 ? ? -69.78 88.22 50 10 LYS A 18 ? ? 33.90 37.37 51 10 SER A 22 ? ? -37.13 139.04 52 10 PRO A 23 ? ? -69.76 3.60 53 10 SER A 24 ? ? -104.53 -60.95 54 10 ARG A 30 ? ? -132.13 -42.21 55 10 TRP A 32 ? ? 31.83 51.86 56 10 ARG A 35 ? ? -57.03 92.73 57 10 CYS A 42 ? ? -84.30 42.85 58 11 LYS A 18 ? ? 70.06 49.03 59 11 PHE A 20 ? ? -37.65 123.73 60 11 PRO A 23 ? ? -69.81 4.52 61 11 PHE A 29 ? ? -82.23 31.49 62 11 ARG A 30 ? ? -134.92 -45.55 63 11 TRP A 32 ? ? 35.20 53.17 64 11 ARG A 35 ? ? -57.42 102.29 65 12 LYS A 18 ? ? 37.57 32.25 66 12 TRP A 32 ? ? 33.75 52.74 67 12 TRP A 38 ? ? -37.42 113.94 68 12 CYS A 42 ? ? -35.11 125.70 69 12 LEU A 45 ? ? -69.01 96.10 70 13 SER A 2 ? ? -38.55 123.10 71 13 SER A 5 ? ? -60.46 92.22 72 13 GLU A 16 ? ? -134.64 -40.87 73 13 LYS A 18 ? ? 35.22 44.18 74 13 PRO A 23 ? ? -69.75 4.08 75 13 TYR A 39 ? ? -42.73 108.02 76 13 CYS A 42 ? ? -39.53 -39.34 77 13 SER A 48 ? ? -66.16 95.28 78 14 PRO A 23 ? ? -69.76 4.83 79 14 PHE A 29 ? ? -81.96 33.99 80 14 ARG A 30 ? ? -134.70 -38.89 81 14 ARG A 35 ? ? -37.89 124.37 82 14 ASP A 41 ? ? -57.48 91.65 83 14 SER A 43 ? ? 71.57 42.12 84 15 SER A 8 ? ? -103.69 42.18 85 15 GLU A 16 ? ? -75.95 -70.59 86 15 PHE A 20 ? ? -36.04 132.72 87 15 PHE A 29 ? ? -83.10 33.14 88 15 ARG A 30 ? ? -134.50 -38.40 89 15 THR A 46 ? ? -37.19 137.00 90 15 HIS A 47 ? ? -59.46 101.21 91 16 GLU A 9 ? ? -38.48 146.95 92 16 PRO A 23 ? ? -69.74 3.09 93 16 LYS A 25 ? ? -48.28 161.80 94 16 CYS A 28 ? ? -34.83 112.87 95 16 PHE A 29 ? ? -83.70 35.76 96 16 ARG A 30 ? ? -133.20 -38.48 97 16 LEU A 34 ? ? -38.89 148.92 98 16 ASP A 37 ? ? -37.01 125.81 99 16 ASP A 41 ? ? 38.72 44.89 100 16 HIS A 47 ? ? -97.97 41.28 101 17 THR A 15 ? ? -84.79 30.74 102 17 GLU A 16 ? ? -133.39 -46.26 103 17 ARG A 30 ? ? -134.38 -38.15 104 17 TRP A 32 ? ? 31.77 54.98 105 17 LEU A 34 ? ? -52.28 178.49 106 17 TYR A 39 ? ? -44.99 168.94 107 17 SER A 43 ? ? -174.23 133.48 108 18 SER A 2 ? ? -38.66 143.49 109 18 LYS A 18 ? ? 45.31 28.87 110 18 PRO A 23 ? ? -69.76 2.97 111 18 PHE A 29 ? ? -84.00 30.80 112 18 ARG A 30 ? ? -131.75 -39.12 113 18 ARG A 35 ? ? -49.21 150.08 114 18 SER A 52 ? ? 34.86 43.10 115 19 SER A 3 ? ? -97.08 -63.10 116 19 SER A 5 ? ? -92.81 -66.52 117 19 THR A 15 ? ? -85.85 30.99 118 19 GLU A 16 ? ? -133.07 -43.83 119 19 PHE A 29 ? ? -84.21 31.20 120 19 ARG A 30 ? ? -134.95 -39.70 121 19 TRP A 32 ? ? 34.44 48.03 122 19 LEU A 34 ? ? -44.76 159.02 123 19 PRO A 50 ? ? -69.80 3.57 124 19 SER A 51 ? ? 74.11 39.99 125 20 SER A 8 ? ? -68.32 83.48 126 20 GLU A 9 ? ? -91.41 42.21 127 20 GLU A 16 ? ? -92.09 -66.31 128 20 PRO A 23 ? ? -69.78 2.86 129 20 TRP A 32 ? ? 33.64 55.03 130 20 TRP A 38 ? ? 34.20 55.08 131 20 LEU A 45 ? ? -122.45 -54.04 132 20 THR A 46 ? ? -43.08 163.19 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #