data_2CS4 # _entry.id 2CS4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CS4 pdb_00002cs4 10.2210/pdb2cs4/pdb RCSB RCSB024561 ? ? WWPDB D_1000024561 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002022477.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CS4 _pdbx_database_status.recvd_initial_deposition_date 2005-05-20 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagashima, T.' 1 'Hayashi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of N-terminal domain of chromosome 12 open reading frame 2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nagashima, T.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein C12orf2' _entity.formula_weight 10332.687 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RA domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Carcinoma associated protein HOJ-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASDV QLILRRTGPSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASDV QLILRRTGPSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002022477.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 GLU n 1 10 LEU n 1 11 LYS n 1 12 VAL n 1 13 TRP n 1 14 VAL n 1 15 ASP n 1 16 GLY n 1 17 VAL n 1 18 GLN n 1 19 ARG n 1 20 ILE n 1 21 VAL n 1 22 CYS n 1 23 GLY n 1 24 VAL n 1 25 THR n 1 26 GLU n 1 27 VAL n 1 28 THR n 1 29 THR n 1 30 CYS n 1 31 GLN n 1 32 GLU n 1 33 VAL n 1 34 VAL n 1 35 ILE n 1 36 ALA n 1 37 LEU n 1 38 ALA n 1 39 GLN n 1 40 ALA n 1 41 ILE n 1 42 GLY n 1 43 ARG n 1 44 THR n 1 45 GLY n 1 46 ARG n 1 47 TYR n 1 48 THR n 1 49 LEU n 1 50 ILE n 1 51 GLU n 1 52 LYS n 1 53 TRP n 1 54 ARG n 1 55 ASP n 1 56 THR n 1 57 GLU n 1 58 ARG n 1 59 HIS n 1 60 LEU n 1 61 ALA n 1 62 PRO n 1 63 HIS n 1 64 GLU n 1 65 ASN n 1 66 PRO n 1 67 ILE n 1 68 ILE n 1 69 SER n 1 70 LEU n 1 71 ASN n 1 72 LYS n 1 73 TRP n 1 74 GLY n 1 75 GLN n 1 76 TYR n 1 77 ALA n 1 78 SER n 1 79 ASP n 1 80 VAL n 1 81 GLN n 1 82 LEU n 1 83 ILE n 1 84 LEU n 1 85 ARG n 1 86 ARG n 1 87 THR n 1 88 GLY n 1 89 PRO n 1 90 SER n 1 91 GLY n 1 92 PRO n 1 93 SER n 1 94 SER n 1 95 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene C12orf2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041129-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RASF8_HUMAN _struct_ref.pdbx_db_accession Q8NHQ8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRT GP ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CS4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8NHQ8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CS4 GLY A 1 ? UNP Q8NHQ8 ? ? 'cloning artifact' 1 1 1 2CS4 SER A 2 ? UNP Q8NHQ8 ? ? 'cloning artifact' 2 2 1 2CS4 SER A 3 ? UNP Q8NHQ8 ? ? 'cloning artifact' 3 3 1 2CS4 GLY A 4 ? UNP Q8NHQ8 ? ? 'cloning artifact' 4 4 1 2CS4 SER A 5 ? UNP Q8NHQ8 ? ? 'cloning artifact' 5 5 1 2CS4 SER A 6 ? UNP Q8NHQ8 ? ? 'cloning artifact' 6 6 1 2CS4 GLY A 7 ? UNP Q8NHQ8 ? ? 'cloning artifact' 7 7 1 2CS4 SER A 90 ? UNP Q8NHQ8 ? ? 'cloning artifact' 90 8 1 2CS4 GLY A 91 ? UNP Q8NHQ8 ? ? 'cloning artifact' 91 9 1 2CS4 PRO A 92 ? UNP Q8NHQ8 ? ? 'cloning artifact' 92 10 1 2CS4 SER A 93 ? UNP Q8NHQ8 ? ? 'cloning artifact' 93 11 1 2CS4 SER A 94 ? UNP Q8NHQ8 ? ? 'cloning artifact' 94 12 1 2CS4 GLY A 95 ? UNP Q8NHQ8 ? ? 'cloning artifact' 95 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.99mM RA domain U-13C, 15N; 20mM TrisHCl, 100mM NaCl, 1mM DTT, 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CS4 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CS4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CS4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.901 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CS4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CS4 _struct.title 'Solution structure of N-terminal domain of chromosome 12 open reading frame 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CS4 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, SIGNALING PROTEIN' _struct_keywords.text ;GTP binding, ubiquitin fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 29 ? GLY A 42 ? THR A 29 GLY A 42 1 ? 14 HELX_P HELX_P2 2 ASN A 65 ? LYS A 72 ? ASN A 65 LYS A 72 1 ? 8 HELX_P HELX_P3 3 TRP A 73 ? ALA A 77 ? TRP A 73 ALA A 77 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 17 ? ARG A 19 ? VAL A 17 ARG A 19 A 2 VAL A 12 ? VAL A 14 ? VAL A 12 VAL A 14 A 3 GLN A 81 ? GLY A 88 ? GLN A 81 GLY A 88 A 4 ARG A 46 ? TRP A 53 ? ARG A 46 TRP A 53 A 5 THR A 56 ? HIS A 59 ? THR A 56 HIS A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 17 ? O VAL A 17 N VAL A 14 ? N VAL A 14 A 2 3 N TRP A 13 ? N TRP A 13 O LEU A 82 ? O LEU A 82 A 3 4 O GLN A 81 ? O GLN A 81 N LYS A 52 ? N LYS A 52 A 4 5 N GLU A 51 ? N GLU A 51 O ARG A 58 ? O ARG A 58 # _database_PDB_matrix.entry_id 2CS4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CS4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLY 95 95 95 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-20 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 43 ? ? -35.39 150.26 2 1 ARG A 54 ? ? 35.01 39.05 3 1 TYR A 76 ? ? -108.79 42.67 4 2 ARG A 43 ? ? -37.44 142.78 5 2 ARG A 54 ? ? 35.75 33.61 6 3 GLU A 64 ? ? -59.41 177.33 7 3 THR A 87 ? ? -113.70 79.01 8 3 PRO A 92 ? ? -69.78 93.29 9 3 SER A 94 ? ? -125.91 -52.41 10 4 GLN A 31 ? ? -63.78 -72.05 11 4 GLU A 32 ? ? -35.00 -32.77 12 4 ARG A 43 ? ? -49.79 108.10 13 4 ARG A 54 ? ? 37.96 41.04 14 4 ASP A 55 ? ? 71.04 40.00 15 4 PRO A 89 ? ? -69.77 95.86 16 5 SER A 3 ? ? -126.70 -53.14 17 5 SER A 5 ? ? -96.68 -64.00 18 5 THR A 44 ? ? -34.27 148.24 19 5 ARG A 46 ? ? -160.94 118.81 20 5 ARG A 54 ? ? 34.46 41.78 21 5 TYR A 76 ? ? -108.24 42.91 22 6 ARG A 54 ? ? 36.17 42.77 23 6 SER A 69 ? ? -39.26 -33.00 24 6 ASN A 71 ? ? -34.38 -34.37 25 6 PRO A 89 ? ? -69.78 98.51 26 6 PRO A 92 ? ? -69.73 -177.61 27 7 SER A 3 ? ? -166.84 117.19 28 7 TRP A 13 ? ? -59.99 106.39 29 7 ARG A 46 ? ? -58.28 109.26 30 7 ARG A 54 ? ? 34.36 42.00 31 9 SER A 6 ? ? -34.92 116.48 32 9 SER A 94 ? ? -170.16 129.35 33 10 SER A 3 ? ? -38.89 124.41 34 10 VAL A 33 ? ? -86.34 -70.59 35 10 TYR A 76 ? ? -106.01 43.91 36 10 PRO A 89 ? ? -69.76 98.09 37 10 SER A 90 ? ? 34.37 48.11 38 11 ARG A 46 ? ? -60.51 99.98 39 11 TYR A 76 ? ? -103.57 42.66 40 11 PRO A 92 ? ? -69.76 91.02 41 12 SER A 2 ? ? -48.47 155.21 42 12 ASP A 15 ? ? 71.19 30.95 43 12 THR A 44 ? ? -56.21 -70.74 44 12 THR A 87 ? ? -170.04 118.54 45 12 SER A 94 ? ? -45.50 105.15 46 13 THR A 28 ? ? -49.63 104.95 47 13 ARG A 54 ? ? 39.84 45.23 48 14 VAL A 33 ? ? -74.76 -72.58 49 15 ARG A 54 ? ? 49.18 25.02 50 15 ASP A 55 ? ? 73.42 32.37 51 15 TYR A 76 ? ? -103.14 40.64 52 16 VAL A 34 ? ? -64.91 -70.08 53 16 ASP A 55 ? ? 71.69 30.49 54 16 SER A 94 ? ? -37.10 108.06 55 17 ARG A 43 ? ? -36.67 133.53 56 17 THR A 87 ? ? -93.06 53.68 57 18 SER A 5 ? ? -39.11 101.86 58 18 SER A 6 ? ? -41.93 99.96 59 18 VAL A 33 ? ? -66.95 -71.33 60 18 ARG A 46 ? ? -39.22 134.37 61 18 ARG A 54 ? ? 39.47 44.58 62 19 SER A 3 ? ? -131.20 -61.39 63 19 SER A 90 ? ? -173.33 138.08 64 20 SER A 5 ? ? -97.17 -60.78 65 20 TRP A 13 ? ? -60.55 98.75 66 20 THR A 29 ? ? -69.18 -175.55 67 20 ALA A 40 ? ? -96.81 -66.38 68 20 ARG A 46 ? ? -97.55 53.94 69 20 SER A 90 ? ? -169.24 107.65 70 20 SER A 93 ? ? -43.50 167.11 #