data_2CT0 # _entry.id 2CT0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2CT0 pdb_00002ct0 10.2210/pdb2ct0/pdb RCSB RCSB024589 ? ? WWPDB D_1000024589 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002014231.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2CT0 _pdbx_database_status.recvd_initial_deposition_date 2005-05-23 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miyamoto, K.' 1 'Sato, M.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the RING domain of the Non-SMC element 1 protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miyamoto, K.' 1 ? primary 'Sato, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Non-SMC element 1 homolog' 8048.058 1 ? ? 'RING domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002014231.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 GLU n 1 10 THR n 1 11 TYR n 1 12 PRO n 1 13 ASP n 1 14 ALA n 1 15 VAL n 1 16 LYS n 1 17 ILE n 1 18 CYS n 1 19 ASN n 1 20 ILE n 1 21 CYS n 1 22 HIS n 1 23 SER n 1 24 LEU n 1 25 LEU n 1 26 ILE n 1 27 GLN n 1 28 GLY n 1 29 GLN n 1 30 SER n 1 31 CYS n 1 32 GLU n 1 33 THR n 1 34 CYS n 1 35 GLY n 1 36 ILE n 1 37 ARG n 1 38 MET n 1 39 HIS n 1 40 LEU n 1 41 PRO n 1 42 CYS n 1 43 VAL n 1 44 ALA n 1 45 LYS n 1 46 TYR n 1 47 PHE n 1 48 GLN n 1 49 SER n 1 50 ASN n 1 51 ALA n 1 52 GLU n 1 53 PRO n 1 54 ARG n 1 55 CYS n 1 56 PRO n 1 57 HIS n 1 58 CYS n 1 59 ASN n 1 60 ASP n 1 61 TYR n 1 62 TRP n 1 63 PRO n 1 64 HIS n 1 65 GLU n 1 66 ILE n 1 67 PRO n 1 68 LYS n 1 69 SER n 1 70 GLY n 1 71 PRO n 1 72 SER n 1 73 SER n 1 74 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene NSE1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041101-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8WV22_HUMAN _struct_ref.pdbx_db_accession Q8WV22 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPK _struct_ref.pdbx_align_begin 171 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2CT0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WV22 _struct_ref_seq.db_align_beg 171 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2CT0 GLY A 1 ? UNP Q8WV22 ? ? 'cloning artifact' 1 1 1 2CT0 SER A 2 ? UNP Q8WV22 ? ? 'cloning artifact' 2 2 1 2CT0 SER A 3 ? UNP Q8WV22 ? ? 'cloning artifact' 3 3 1 2CT0 GLY A 4 ? UNP Q8WV22 ? ? 'cloning artifact' 4 4 1 2CT0 SER A 5 ? UNP Q8WV22 ? ? 'cloning artifact' 5 5 1 2CT0 SER A 6 ? UNP Q8WV22 ? ? 'cloning artifact' 6 6 1 2CT0 GLY A 7 ? UNP Q8WV22 ? ? 'cloning artifact' 7 7 1 2CT0 SER A 69 ? UNP Q8WV22 ? ? 'cloning artifact' 69 8 1 2CT0 GLY A 70 ? UNP Q8WV22 ? ? 'cloning artifact' 70 9 1 2CT0 PRO A 71 ? UNP Q8WV22 ? ? 'cloning artifact' 71 10 1 2CT0 SER A 72 ? UNP Q8WV22 ? ? 'cloning artifact' 72 11 1 2CT0 SER A 73 ? UNP Q8WV22 ? ? 'cloning artifact' 73 12 1 2CT0 GLY A 74 ? UNP Q8WV22 ? ? 'cloning artifact' 74 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.27mM RING domain U-13C,15N; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZNCl2; 0.1mM NTA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2CT0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2CT0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2CT0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.925 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2CT0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2CT0 _struct.title 'Solution structure of the RING domain of the Non-SMC element 1 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2CT0 _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text ;Non-SMC element 1, RING domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 40 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 46 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 40 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 46 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.374 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc3 metalc ? ? A CYS 31 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 31 A ZN 401 1_555 ? ? ? ? ? ? ? 2.377 ? ? metalc4 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 401 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc5 metalc ? ? A HIS 39 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 39 A ZN 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc6 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc7 metalc ? ? A CYS 55 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 401 1_555 ? ? ? ? ? ? ? 2.378 ? ? metalc8 metalc ? ? A CYS 58 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 58 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 29 ? SER A 30 ? GLN A 29 SER A 30 A 2 ARG A 37 ? MET A 38 ? ARG A 37 MET A 38 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 29 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 29 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id MET _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 38 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id MET _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 38 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 39 ? HIS A 39 . ? 1_555 ? 4 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 5 AC2 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 6 AC2 4 CYS A 34 ? CYS A 34 . ? 1_555 ? 7 AC2 4 CYS A 55 ? CYS A 55 . ? 1_555 ? 8 AC2 4 CYS A 58 ? CYS A 58 . ? 1_555 ? # _database_PDB_matrix.entry_id 2CT0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2CT0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 109.3 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 92.9 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 94.1 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 117.3 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 119.3 ? 6 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 118.9 ? 7 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 115.4 ? 8 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 101.2 ? 9 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 108.8 ? 10 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 112.6 ? 11 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 117.5 ? 12 SG ? A CYS 55 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 98.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-23 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_ref_seq_dif.details' 19 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 15 ? ? -134.48 -50.14 2 1 ILE A 26 ? ? -128.25 -59.00 3 1 ALA A 51 ? ? -94.49 -60.48 4 1 PRO A 56 ? ? -69.72 0.67 5 1 HIS A 57 ? ? -106.41 -71.00 6 1 TYR A 61 ? ? -175.29 146.06 7 1 PRO A 71 ? ? -69.78 4.67 8 1 SER A 73 ? ? 70.31 44.48 9 2 SER A 2 ? ? -35.49 128.85 10 2 SER A 6 ? ? -61.56 91.35 11 2 ILE A 26 ? ? -133.26 -42.42 12 2 HIS A 39 ? ? -54.15 170.30 13 2 PRO A 56 ? ? -69.76 5.77 14 2 ASN A 59 ? ? 72.36 38.75 15 2 LYS A 68 ? ? -47.28 150.93 16 2 SER A 73 ? ? -90.13 41.27 17 3 LYS A 16 ? ? -31.15 115.61 18 3 HIS A 39 ? ? -53.41 173.87 19 3 ALA A 51 ? ? -57.82 -176.13 20 3 GLU A 52 ? ? -33.07 126.71 21 3 HIS A 57 ? ? -91.72 -69.13 22 3 ASN A 59 ? ? 74.94 52.20 23 3 TYR A 61 ? ? -175.72 148.89 24 4 THR A 10 ? ? -31.68 128.47 25 4 ALA A 14 ? ? -84.23 30.59 26 4 LYS A 16 ? ? -65.86 95.17 27 4 ALA A 51 ? ? -93.81 -64.80 28 4 PRO A 56 ? ? -69.70 5.29 29 4 ASN A 59 ? ? 31.27 50.32 30 5 ARG A 8 ? ? -46.03 103.33 31 5 ALA A 14 ? ? -81.95 33.27 32 5 ALA A 51 ? ? -95.53 -64.82 33 5 HIS A 57 ? ? -104.90 -69.66 34 5 TYR A 61 ? ? -175.16 137.17 35 6 SER A 3 ? ? -170.25 146.58 36 6 GLU A 9 ? ? -35.88 133.58 37 6 LYS A 16 ? ? -63.05 98.12 38 6 GLN A 27 ? ? -135.01 -71.97 39 6 ALA A 51 ? ? -90.85 -66.86 40 6 HIS A 57 ? ? -103.55 -70.08 41 6 TYR A 61 ? ? -174.18 135.43 42 6 SER A 72 ? ? -171.07 131.18 43 7 ARG A 8 ? ? -56.57 179.88 44 7 GLU A 9 ? ? -48.50 176.55 45 7 LYS A 16 ? ? -68.82 94.68 46 7 ILE A 26 ? ? -132.10 -42.83 47 7 PRO A 56 ? ? -69.78 5.23 48 7 ASN A 59 ? ? 32.19 36.91 49 7 TRP A 62 ? ? -53.89 109.94 50 7 PRO A 67 ? ? -69.75 -173.69 51 8 ARG A 8 ? ? -46.54 152.87 52 8 GLU A 9 ? ? -163.97 118.35 53 8 THR A 10 ? ? -174.52 130.16 54 8 ALA A 14 ? ? -77.37 47.48 55 8 VAL A 15 ? ? -132.70 -33.72 56 8 CYS A 18 ? ? -45.66 167.46 57 8 GLN A 48 ? ? -42.59 166.47 58 8 SER A 49 ? ? -30.38 95.91 59 8 HIS A 57 ? ? -104.29 -70.37 60 8 ASN A 59 ? ? 70.59 45.88 61 8 ASP A 60 ? ? -107.38 -65.43 62 8 TYR A 61 ? ? -174.28 140.79 63 8 PRO A 71 ? ? -69.78 -176.02 64 9 VAL A 15 ? ? -134.04 -50.49 65 9 CYS A 18 ? ? -49.45 165.32 66 9 HIS A 22 ? ? 70.30 42.79 67 9 ILE A 26 ? ? -130.79 -42.98 68 9 GLN A 27 ? ? -129.93 -74.33 69 9 CYS A 55 ? ? -39.66 127.94 70 9 HIS A 57 ? ? -105.96 -70.77 71 9 TYR A 61 ? ? -175.03 136.48 72 9 SER A 69 ? ? -165.69 117.45 73 10 ARG A 8 ? ? -38.33 144.96 74 10 GLU A 9 ? ? -88.35 47.25 75 10 ILE A 26 ? ? -134.88 -31.05 76 10 HIS A 57 ? ? -101.27 -72.32 77 10 ASN A 59 ? ? 70.49 49.82 78 10 TYR A 61 ? ? -174.85 122.17 79 10 PRO A 71 ? ? -69.73 1.88 80 11 ARG A 8 ? ? -96.97 -66.99 81 11 LYS A 16 ? ? -63.78 95.26 82 11 HIS A 39 ? ? -57.82 171.18 83 11 PRO A 56 ? ? -69.73 2.24 84 11 HIS A 57 ? ? -109.37 -65.54 85 11 TYR A 61 ? ? -172.53 138.34 86 12 SER A 5 ? ? 71.08 43.74 87 12 THR A 10 ? ? -175.52 135.82 88 12 ALA A 14 ? ? -92.26 42.58 89 12 LYS A 16 ? ? -41.30 109.09 90 12 GLN A 27 ? ? 70.01 53.29 91 12 ALA A 51 ? ? -93.05 -62.01 92 12 PRO A 56 ? ? -69.75 1.45 93 12 HIS A 57 ? ? -109.44 -69.68 94 12 TYR A 61 ? ? -175.07 129.78 95 13 LYS A 16 ? ? -66.70 89.33 96 13 HIS A 22 ? ? 73.03 33.80 97 13 HIS A 39 ? ? -56.62 170.44 98 13 SER A 49 ? ? 31.80 47.30 99 13 ALA A 51 ? ? -90.03 -68.64 100 13 PRO A 56 ? ? -69.75 5.84 101 13 ASN A 59 ? ? 71.25 41.19 102 13 TYR A 61 ? ? -36.60 129.39 103 13 PRO A 67 ? ? -69.74 -174.71 104 14 ALA A 14 ? ? -87.60 38.50 105 14 VAL A 15 ? ? -130.71 -30.68 106 14 LYS A 16 ? ? -36.88 111.78 107 14 ILE A 26 ? ? -130.81 -57.07 108 14 SER A 49 ? ? 71.10 32.24 109 14 ALA A 51 ? ? -87.47 -76.54 110 14 PRO A 56 ? ? -69.70 2.79 111 14 ASP A 60 ? ? -104.92 -66.28 112 14 TYR A 61 ? ? -175.23 138.47 113 14 PRO A 67 ? ? -69.80 -179.89 114 14 PRO A 71 ? ? -69.78 85.40 115 14 SER A 72 ? ? -126.32 -56.50 116 15 THR A 10 ? ? -176.09 132.22 117 15 LYS A 16 ? ? -64.53 88.65 118 15 HIS A 22 ? ? 71.09 39.27 119 15 ILE A 26 ? ? -96.24 -67.31 120 15 GLN A 27 ? ? -126.41 -68.15 121 15 PRO A 56 ? ? -69.75 5.47 122 15 HIS A 57 ? ? -115.30 -70.69 123 15 ASN A 59 ? ? 71.81 35.41 124 15 TYR A 61 ? ? -35.87 125.82 125 16 SER A 5 ? ? -41.98 163.33 126 16 HIS A 22 ? ? 70.65 41.53 127 16 ILE A 26 ? ? -122.56 -65.24 128 16 HIS A 57 ? ? -105.06 -69.17 129 16 ASP A 60 ? ? -106.24 -65.66 130 16 TYR A 61 ? ? -175.46 142.61 131 16 PRO A 71 ? ? -69.72 2.44 132 16 SER A 73 ? ? -42.21 150.87 133 17 THR A 10 ? ? -175.46 133.42 134 17 PRO A 56 ? ? -69.77 5.53 135 17 ASN A 59 ? ? 74.91 38.56 136 17 PRO A 63 ? ? -69.68 3.61 137 17 PRO A 67 ? ? -69.79 -173.23 138 17 SER A 73 ? ? 39.36 42.36 139 18 SER A 5 ? ? -83.93 42.39 140 18 ILE A 26 ? ? -130.60 -44.25 141 18 GLU A 32 ? ? -83.68 30.16 142 18 THR A 33 ? ? -120.89 -56.77 143 18 HIS A 39 ? ? -48.70 156.78 144 18 GLN A 48 ? ? -42.51 98.36 145 18 SER A 49 ? ? 31.93 48.99 146 18 ALA A 51 ? ? -90.35 -70.29 147 18 PRO A 56 ? ? -69.69 5.49 148 18 ASN A 59 ? ? 74.71 41.79 149 18 TYR A 61 ? ? -37.89 124.98 150 18 PRO A 63 ? ? -69.71 3.08 151 18 SER A 69 ? ? -103.00 41.18 152 19 SER A 3 ? ? -54.54 103.91 153 19 ARG A 8 ? ? 38.28 34.80 154 19 GLN A 48 ? ? -43.99 169.37 155 19 SER A 49 ? ? -32.34 93.07 156 19 ALA A 51 ? ? -97.99 -66.87 157 19 PRO A 56 ? ? -69.82 5.47 158 19 ASN A 59 ? ? 32.62 35.74 159 20 SER A 5 ? ? -34.67 112.61 160 20 LYS A 16 ? ? -55.69 97.48 161 20 ILE A 26 ? ? -130.42 -66.62 162 20 ALA A 51 ? ? -102.05 -65.07 163 20 PRO A 56 ? ? -69.71 6.75 164 20 PRO A 71 ? ? -69.71 -178.21 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #