data_2D8J # _entry.id 2D8J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2D8J pdb_00002d8j 10.2210/pdb2d8j/pdb RCSB RCSB025120 ? ? WWPDB D_1000025120 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt008000775.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2D8J _pdbx_database_status.recvd_initial_deposition_date 2005-12-06 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Kurosaki, C.' 2 'Yoshida, M.' 3 'Hayashi, F.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the SH3 domain of Fyn-related kinase' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Kurosaki, C.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'fyn-related kinase' _entity.formula_weight 8333.002 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.112 _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGQYFVALFDYQARTAEDLSFRAGDKLQVLDTSHEGWWLARHLEKKGTGLGQQLQGYIPSNYVAEDSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGQYFVALFDYQARTAEDLSFRAGDKLQVLDTSHEGWWLARHLEKKGTGLGQQLQGYIPSNYVAEDSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt008000775.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 TYR n 1 10 PHE n 1 11 VAL n 1 12 ALA n 1 13 LEU n 1 14 PHE n 1 15 ASP n 1 16 TYR n 1 17 GLN n 1 18 ALA n 1 19 ARG n 1 20 THR n 1 21 ALA n 1 22 GLU n 1 23 ASP n 1 24 LEU n 1 25 SER n 1 26 PHE n 1 27 ARG n 1 28 ALA n 1 29 GLY n 1 30 ASP n 1 31 LYS n 1 32 LEU n 1 33 GLN n 1 34 VAL n 1 35 LEU n 1 36 ASP n 1 37 THR n 1 38 SER n 1 39 HIS n 1 40 GLU n 1 41 GLY n 1 42 TRP n 1 43 TRP n 1 44 LEU n 1 45 ALA n 1 46 ARG n 1 47 HIS n 1 48 LEU n 1 49 GLU n 1 50 LYS n 1 51 LYS n 1 52 GLY n 1 53 THR n 1 54 GLY n 1 55 LEU n 1 56 GLY n 1 57 GLN n 1 58 GLN n 1 59 LEU n 1 60 GLN n 1 61 GLY n 1 62 TYR n 1 63 ILE n 1 64 PRO n 1 65 SER n 1 66 ASN n 1 67 TYR n 1 68 VAL n 1 69 ALA n 1 70 GLU n 1 71 ASP n 1 72 SER n 1 73 GLY n 1 74 PRO n 1 75 SER n 1 76 SER n 1 77 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene FrK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050425-22 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code NP_034367 _struct_ref.pdbx_db_accession 31542823 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QYFVALFDYQARTAEDLSFRAGDKLQVLDTSHEGWWLARHLEKKGTGLGQQLQGYIPSNYVAED _struct_ref.pdbx_align_begin 52 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2D8J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 31542823 _struct_ref_seq.db_align_beg 52 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 115 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2D8J GLY A 1 ? GB 31542823 ? ? 'cloning artifact' 1 1 1 2D8J SER A 2 ? GB 31542823 ? ? 'cloning artifact' 2 2 1 2D8J SER A 3 ? GB 31542823 ? ? 'cloning artifact' 3 3 1 2D8J GLY A 4 ? GB 31542823 ? ? 'cloning artifact' 4 4 1 2D8J SER A 5 ? GB 31542823 ? ? 'cloning artifact' 5 5 1 2D8J SER A 6 ? GB 31542823 ? ? 'cloning artifact' 6 6 1 2D8J GLY A 7 ? GB 31542823 ? ? 'cloning artifact' 7 7 1 2D8J SER A 72 ? GB 31542823 ? ? 'cloning artifact' 72 8 1 2D8J GLY A 73 ? GB 31542823 ? ? 'cloning artifact' 73 9 1 2D8J PRO A 74 ? GB 31542823 ? ? 'cloning artifact' 74 10 1 2D8J SER A 75 ? GB 31542823 ? ? 'cloning artifact' 75 11 1 2D8J SER A 76 ? GB 31542823 ? ? 'cloning artifact' 76 12 1 2D8J GLY A 77 ? GB 31542823 ? ? 'cloning artifact' 77 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.17mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model ECA _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2D8J _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2D8J _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2D8J _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection 'Delta NMR' 4.3 JEOL 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9296 'Kobayashi, N' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2D8J _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2D8J _struct.title 'Solution structure of the SH3 domain of Fyn-related kinase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2D8J _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;SH3 domain, Fyn-related kinase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 60 ? PRO A 64 ? GLN A 60 PRO A 64 A 2 TRP A 42 ? HIS A 47 ? TRP A 42 HIS A 47 A 3 LEU A 32 ? ASP A 36 ? LEU A 32 ASP A 36 A 4 GLN A 8 ? ALA A 12 ? GLN A 8 ALA A 12 A 5 VAL A 68 ? GLU A 70 ? VAL A 68 GLU A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 63 ? O ILE A 63 N TRP A 43 ? N TRP A 43 A 2 3 O LEU A 44 ? O LEU A 44 N LEU A 35 ? N LEU A 35 A 3 4 O LEU A 32 ? O LEU A 32 N PHE A 10 ? N PHE A 10 A 4 5 N VAL A 11 ? N VAL A 11 O ALA A 69 ? O ALA A 69 # _database_PDB_matrix.entry_id 2D8J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2D8J _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLY 77 77 77 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-06 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -58.19 171.85 2 1 SER A 38 ? ? -88.16 45.94 3 1 HIS A 39 ? ? -174.05 119.33 4 1 LYS A 50 ? ? -45.91 152.57 5 1 LYS A 51 ? ? -35.00 134.46 6 2 SER A 2 ? ? -120.77 -55.73 7 2 ALA A 21 ? ? -90.03 35.38 8 2 LYS A 51 ? ? -123.28 -54.54 9 2 GLN A 57 ? ? -91.04 37.55 10 2 PRO A 74 ? ? -69.72 82.84 11 3 ALA A 28 ? ? -59.71 108.90 12 3 HIS A 39 ? ? -59.76 83.82 13 3 GLU A 40 ? ? -36.93 134.11 14 3 PRO A 74 ? ? -69.81 95.54 15 4 ASP A 30 ? ? -41.45 109.89 16 4 GLU A 40 ? ? -92.11 50.52 17 4 LYS A 50 ? ? -172.01 141.91 18 4 LEU A 55 ? ? -37.92 138.04 19 4 LEU A 59 ? ? -48.97 -19.72 20 4 PRO A 74 ? ? -69.80 2.69 21 5 ASP A 30 ? ? -38.26 136.27 22 5 GLU A 40 ? ? -69.40 98.63 23 5 LEU A 55 ? ? -121.37 -62.50 24 5 GLN A 58 ? ? -49.71 173.82 25 5 PRO A 74 ? ? -69.71 93.09 26 5 SER A 76 ? ? -43.50 104.52 27 6 SER A 3 ? ? -55.45 108.73 28 6 ALA A 18 ? ? -53.77 105.68 29 6 ASP A 30 ? ? -35.29 110.72 30 6 HIS A 39 ? ? -66.41 89.21 31 6 LYS A 51 ? ? -102.55 -62.26 32 7 ALA A 18 ? ? -38.49 144.12 33 7 SER A 38 ? ? -89.90 44.12 34 7 HIS A 39 ? ? -171.85 111.80 35 7 GLU A 40 ? ? -68.32 75.61 36 7 THR A 53 ? ? -91.95 40.68 37 7 SER A 75 ? ? -67.78 85.38 38 8 GLU A 22 ? ? -97.23 56.38 39 8 SER A 38 ? ? -86.89 -73.72 40 8 HIS A 39 ? ? -50.41 98.83 41 8 SER A 72 ? ? -53.01 85.43 42 9 ASP A 30 ? ? -39.33 136.45 43 9 SER A 38 ? ? -80.96 -74.71 44 9 HIS A 39 ? ? -55.21 97.36 45 9 GLN A 58 ? ? -59.31 174.00 46 9 SER A 72 ? ? -54.52 102.74 47 10 ALA A 28 ? ? -53.70 107.50 48 10 GLU A 49 ? ? -53.23 102.76 49 11 SER A 5 ? ? -95.10 41.67 50 11 SER A 38 ? ? -80.33 -73.92 51 11 HIS A 39 ? ? -54.00 95.33 52 11 LEU A 55 ? ? -64.55 90.46 53 12 SER A 6 ? ? -52.42 106.54 54 12 HIS A 39 ? ? -63.51 92.71 55 13 SER A 2 ? ? 39.27 42.15 56 13 ALA A 18 ? ? -45.26 99.38 57 13 ALA A 21 ? ? -37.69 -28.37 58 13 GLU A 22 ? ? -102.30 73.84 59 13 SER A 38 ? ? -82.93 -72.78 60 13 GLU A 49 ? ? -52.83 109.92 61 14 SER A 5 ? ? -92.65 54.79 62 14 GLU A 22 ? ? -91.20 57.68 63 14 LYS A 31 ? ? -57.64 104.09 64 14 GLU A 40 ? ? -83.33 40.14 65 14 GLU A 49 ? ? -45.62 154.28 66 14 PRO A 74 ? ? -69.87 93.52 67 15 ALA A 18 ? ? -56.82 106.57 68 15 SER A 38 ? ? -76.51 -74.34 69 15 HIS A 39 ? ? -52.37 99.97 70 15 GLU A 49 ? ? -63.50 84.22 71 15 GLN A 58 ? ? -36.32 137.71 72 15 PRO A 74 ? ? -69.70 89.08 73 16 SER A 3 ? ? -57.01 108.78 74 16 SER A 38 ? ? -74.26 -74.85 75 16 HIS A 39 ? ? -52.52 102.49 76 16 LYS A 51 ? ? -174.49 135.46 77 16 LEU A 59 ? ? -131.78 -35.38 78 16 SER A 72 ? ? -47.32 154.79 79 17 SER A 5 ? ? -96.01 43.46 80 17 SER A 6 ? ? -57.73 108.41 81 17 ALA A 18 ? ? -38.33 127.04 82 17 ASP A 30 ? ? -34.83 136.88 83 17 HIS A 39 ? ? -59.28 79.63 84 17 GLU A 40 ? ? -36.87 139.86 85 17 LYS A 50 ? ? -95.05 42.21 86 17 GLN A 57 ? ? 34.28 35.79 87 18 SER A 3 ? ? -35.39 143.15 88 18 HIS A 39 ? ? -170.62 109.06 89 19 SER A 5 ? ? -173.02 134.22 90 19 HIS A 39 ? ? -56.97 106.00 91 19 PRO A 74 ? ? -69.79 2.23 92 19 SER A 76 ? ? -37.18 131.41 93 20 ALA A 18 ? ? -34.24 119.03 94 20 GLU A 22 ? ? -94.99 48.98 95 20 GLN A 58 ? ? -38.60 123.74 96 20 SER A 75 ? ? -62.54 97.96 #