data_2DG4 # _entry.id 2DG4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2DG4 pdb_00002dg4 10.2210/pdb2dg4/pdb RCSB RCSB025377 ? ? WWPDB D_1000025377 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2DG3 'The wildtype FBP12' unspecified PDB 2DG9 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2DG4 _pdbx_database_status.recvd_initial_deposition_date 2006-03-08 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Buckle, A.M.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Energetic and structural analysis of the role of tryptophan 59 in FKBP12' _citation.journal_abbrev Biochemistry _citation.journal_volume 42 _citation.page_first 2364 _citation.page_last 2372 _citation.year 2003 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12600203 _citation.pdbx_database_id_DOI 10.1021/bi020564a # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fulton, K.F.' 1 ? primary 'Jackson, S.E.' 2 ? primary 'Buckle, A.M.' 3 ? # _cell.entry_id 2DG4 _cell.length_a 44.486 _cell.length_b 49.097 _cell.length_c 51.740 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2DG4 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'FK506-binding protein 1A' 11797.472 1 5.2.1.8 ? ? ? 2 non-polymer syn 'RAPAMYCIN IMMUNOSUPPRESSANT DRUG' 914.172 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 153 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Peptidyl-prolyl cis-trans isomerase, PPIase, Rotamase, 12 kDa FKBP, FKBP-12, Immunophilin FKBP12' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGFEEGVAQMSVGQRAKLTISPDY AYGATGHPGIIPPHATLVFDVELLKLE ; _entity_poly.pdbx_seq_one_letter_code_can ;GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGFEEGVAQMSVGQRAKLTISPDY AYGATGHPGIIPPHATLVFDVELLKLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 GLN n 1 4 VAL n 1 5 GLU n 1 6 THR n 1 7 ILE n 1 8 SER n 1 9 PRO n 1 10 GLY n 1 11 ASP n 1 12 GLY n 1 13 ARG n 1 14 THR n 1 15 PHE n 1 16 PRO n 1 17 LYS n 1 18 ARG n 1 19 GLY n 1 20 GLN n 1 21 THR n 1 22 CYS n 1 23 VAL n 1 24 VAL n 1 25 HIS n 1 26 TYR n 1 27 THR n 1 28 GLY n 1 29 MET n 1 30 LEU n 1 31 GLU n 1 32 ASP n 1 33 GLY n 1 34 LYS n 1 35 LYS n 1 36 PHE n 1 37 ASP n 1 38 SER n 1 39 SER n 1 40 ARG n 1 41 ASP n 1 42 ARG n 1 43 ASN n 1 44 LYS n 1 45 PRO n 1 46 PHE n 1 47 LYS n 1 48 PHE n 1 49 MET n 1 50 LEU n 1 51 GLY n 1 52 LYS n 1 53 GLN n 1 54 GLU n 1 55 VAL n 1 56 ILE n 1 57 ARG n 1 58 GLY n 1 59 PHE n 1 60 GLU n 1 61 GLU n 1 62 GLY n 1 63 VAL n 1 64 ALA n 1 65 GLN n 1 66 MET n 1 67 SER n 1 68 VAL n 1 69 GLY n 1 70 GLN n 1 71 ARG n 1 72 ALA n 1 73 LYS n 1 74 LEU n 1 75 THR n 1 76 ILE n 1 77 SER n 1 78 PRO n 1 79 ASP n 1 80 TYR n 1 81 ALA n 1 82 TYR n 1 83 GLY n 1 84 ALA n 1 85 THR n 1 86 GLY n 1 87 HIS n 1 88 PRO n 1 89 GLY n 1 90 ILE n 1 91 ILE n 1 92 PRO n 1 93 PRO n 1 94 HIS n 1 95 ALA n 1 96 THR n 1 97 LEU n 1 98 VAL n 1 99 PHE n 1 100 ASP n 1 101 VAL n 1 102 GLU n 1 103 LEU n 1 104 LEU n 1 105 LYS n 1 106 LEU n 1 107 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTrcGST _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FKB1A_HUMAN _struct_ref.pdbx_db_accession P62942 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDY AYGATGHPGIIPPHATLVFDVELLKLE ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DG4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62942 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 107 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2DG4 _struct_ref_seq_dif.mon_id PHE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 59 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P62942 _struct_ref_seq_dif.db_mon_id TRP _struct_ref_seq_dif.pdbx_seq_db_seq_num 60 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 59 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RAP non-polymer . 'RAPAMYCIN IMMUNOSUPPRESSANT DRUG' ? 'C51 H79 N O13' 914.172 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2DG4 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_percent_sol 48.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details '30% PEG MME 2000, 0.2M Ammonium Sulphate, pH 4.6, VAPOR DIFFUSION, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2003-08-29 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'OSMIC MIRRORS' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'ELLIOTT GX-13' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 2DG4 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 35.8 _reflns.d_resolution_high 1.7 _reflns.number_obs 12333 _reflns.number_all 12333 _reflns.percent_possible_obs 96.2 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 23.7 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.7 _reflns_shell.d_res_low 35.8 _reflns_shell.percent_possible_all 95.9 _reflns_shell.Rmerge_I_obs 0.178 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.8 _reflns_shell.pdbx_redundancy 3.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2DG4 _refine.ls_number_reflns_obs 11715 _refine.ls_number_reflns_all 18730 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 35.58 _refine.ls_d_res_high 1.70 _refine.ls_percent_reflns_obs 95.60 _refine.ls_R_factor_obs 0.19625 _refine.ls_R_factor_all 0.19625 _refine.ls_R_factor_R_work 0.19535 _refine.ls_R_factor_R_free 0.2135 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 618 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc .946 _refine.correlation_coeff_Fo_to_Fc_free .931 _refine.B_iso_mean 27.221 _refine.aniso_B[1][1] .06 _refine.aniso_B[2][2] .02 _refine.aniso_B[3][3] -.08 _refine.aniso_B[1][2] .00 _refine.aniso_B[1][3] .00 _refine.aniso_B[2][3] .00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii .80 _refine.pdbx_solvent_shrinkage_radii .80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R .127 _refine.pdbx_overall_ESU_R_Free .111 _refine.overall_SU_ML .070 _refine.overall_SU_B 4.061 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 797 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 71 _refine_hist.number_atoms_solvent 153 _refine_hist.number_atoms_total 1021 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 35.58 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d .006 .022 ? 894 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.118 2.057 ? 1213 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.507 5.000 ? 106 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 30.881 24.545 ? 33 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 11.438 15.000 ? 131 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 6.944 15.000 ? 4 'X-RAY DIFFRACTION' ? r_chiral_restr .062 .200 ? 139 'X-RAY DIFFRACTION' ? r_gen_planes_refined .002 .020 ? 665 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined .162 .200 ? 391 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined .309 .200 ? 603 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined .056 .200 ? 120 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined .113 .200 ? 21 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined .062 .200 ? 16 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it .227 1.500 ? 549 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it .378 2.000 ? 848 'X-RAY DIFFRACTION' ? r_scbond_it .478 3.000 ? 381 'X-RAY DIFFRACTION' ? r_scangle_it .714 4.500 ? 365 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.703 _refine_ls_shell.d_res_low 1.747 _refine_ls_shell.number_reflns_R_work 838 _refine_ls_shell.R_factor_R_work 0.234 _refine_ls_shell.percent_reflns_obs 94.09 _refine_ls_shell.R_factor_R_free 0.199 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 37 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2DG4 _struct.title 'FK506-binding protein mutant WF59 complexed with Rapamycin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DG4 _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'IMMUNOPHILIN, ISOMERASE, ROTAMASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 56 ? GLN A 65 ? ILE A 56 GLN A 65 1 ? 10 HELX_P HELX_P2 2 PRO A 78 ? ALA A 81 ? PRO A 78 ALA A 81 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 2 ? SER A 8 ? VAL A 2 SER A 8 A 2 ARG A 71 ? ILE A 76 ? ARG A 71 ILE A 76 A 3 LEU A 97 ? GLU A 107 ? LEU A 97 GLU A 107 A 4 THR A 21 ? LEU A 30 ? THR A 21 LEU A 30 A 5 LYS A 35 ? SER A 38 ? LYS A 35 SER A 38 B 1 VAL A 2 ? SER A 8 ? VAL A 2 SER A 8 B 2 ARG A 71 ? ILE A 76 ? ARG A 71 ILE A 76 B 3 LEU A 97 ? GLU A 107 ? LEU A 97 GLU A 107 B 4 THR A 21 ? LEU A 30 ? THR A 21 LEU A 30 B 5 PHE A 46 ? MET A 49 ? PHE A 46 MET A 49 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 5 ? N GLU A 5 O LYS A 73 ? O LYS A 73 A 2 3 N LEU A 74 ? N LEU A 74 O PHE A 99 ? O PHE A 99 A 3 4 O GLU A 107 ? O GLU A 107 N THR A 21 ? N THR A 21 A 4 5 N GLY A 28 ? N GLY A 28 O ASP A 37 ? O ASP A 37 B 1 2 N GLU A 5 ? N GLU A 5 O LYS A 73 ? O LYS A 73 B 2 3 N LEU A 74 ? N LEU A 74 O PHE A 99 ? O PHE A 99 B 3 4 O GLU A 107 ? O GLU A 107 N THR A 21 ? N THR A 21 B 4 5 N VAL A 24 ? N VAL A 24 O PHE A 46 ? O PHE A 46 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A RAP 501 ? 22 'BINDING SITE FOR RESIDUE RAP A 501' AC2 Software A GOL 1001 ? 4 'BINDING SITE FOR RESIDUE GOL A 1001' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 22 THR A 6 ? THR A 6 . ? 3_555 ? 2 AC1 22 ILE A 7 ? ILE A 7 . ? 3_555 ? 3 AC1 22 TYR A 26 ? TYR A 26 . ? 1_555 ? 4 AC1 22 THR A 27 ? THR A 27 . ? 3_555 ? 5 AC1 22 MET A 29 ? MET A 29 . ? 3_555 ? 6 AC1 22 PHE A 36 ? PHE A 36 . ? 1_555 ? 7 AC1 22 ASP A 37 ? ASP A 37 . ? 1_555 ? 8 AC1 22 PHE A 46 ? PHE A 46 . ? 1_555 ? 9 AC1 22 GLN A 53 ? GLN A 53 . ? 1_555 ? 10 AC1 22 GLU A 54 ? GLU A 54 . ? 1_555 ? 11 AC1 22 VAL A 55 ? VAL A 55 . ? 1_555 ? 12 AC1 22 ILE A 56 ? ILE A 56 . ? 1_555 ? 13 AC1 22 PHE A 59 ? PHE A 59 . ? 1_555 ? 14 AC1 22 LYS A 73 ? LYS A 73 . ? 3_555 ? 15 AC1 22 TYR A 82 ? TYR A 82 . ? 1_555 ? 16 AC1 22 HIS A 87 ? HIS A 87 . ? 1_555 ? 17 AC1 22 ASP A 100 ? ASP A 100 . ? 3_555 ? 18 AC1 22 HOH D . ? HOH A 1034 . ? 3_555 ? 19 AC1 22 HOH D . ? HOH A 1070 . ? 1_555 ? 20 AC1 22 HOH D . ? HOH A 1080 . ? 1_555 ? 21 AC1 22 HOH D . ? HOH A 1127 . ? 1_555 ? 22 AC1 22 HOH D . ? HOH A 1147 . ? 1_555 ? 23 AC2 4 TYR A 82 ? TYR A 82 . ? 1_555 ? 24 AC2 4 ALA A 84 ? ALA A 84 . ? 1_555 ? 25 AC2 4 THR A 85 ? THR A 85 . ? 1_555 ? 26 AC2 4 HOH D . ? HOH A 1086 . ? 1_555 ? # _database_PDB_matrix.entry_id 2DG4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2DG4 _atom_sites.fract_transf_matrix[1][1] 0.022479 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020368 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019327 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RAP 1 501 1 RAP RAP A . C 3 GOL 1 1001 1 GOL GOL A . D 4 HOH 1 1002 1 HOH HOH A . D 4 HOH 2 1003 2 HOH HOH A . D 4 HOH 3 1004 3 HOH HOH A . D 4 HOH 4 1005 4 HOH HOH A . D 4 HOH 5 1006 5 HOH HOH A . D 4 HOH 6 1007 6 HOH HOH A . D 4 HOH 7 1008 7 HOH HOH A . D 4 HOH 8 1009 8 HOH HOH A . D 4 HOH 9 1010 9 HOH HOH A . D 4 HOH 10 1011 10 HOH HOH A . D 4 HOH 11 1012 11 HOH HOH A . D 4 HOH 12 1013 12 HOH HOH A . D 4 HOH 13 1014 13 HOH HOH A . D 4 HOH 14 1015 14 HOH HOH A . D 4 HOH 15 1016 15 HOH HOH A . D 4 HOH 16 1017 16 HOH HOH A . D 4 HOH 17 1018 17 HOH HOH A . D 4 HOH 18 1019 18 HOH HOH A . D 4 HOH 19 1020 19 HOH HOH A . D 4 HOH 20 1021 20 HOH HOH A . D 4 HOH 21 1022 21 HOH HOH A . D 4 HOH 22 1023 22 HOH HOH A . D 4 HOH 23 1024 23 HOH HOH A . D 4 HOH 24 1025 24 HOH HOH A . D 4 HOH 25 1026 25 HOH HOH A . D 4 HOH 26 1027 26 HOH HOH A . D 4 HOH 27 1028 27 HOH HOH A . D 4 HOH 28 1029 28 HOH HOH A . D 4 HOH 29 1030 29 HOH HOH A . D 4 HOH 30 1031 30 HOH HOH A . D 4 HOH 31 1032 31 HOH HOH A . D 4 HOH 32 1033 32 HOH HOH A . D 4 HOH 33 1034 33 HOH HOH A . D 4 HOH 34 1035 34 HOH HOH A . D 4 HOH 35 1036 35 HOH HOH A . D 4 HOH 36 1037 36 HOH HOH A . D 4 HOH 37 1038 37 HOH HOH A . D 4 HOH 38 1039 38 HOH HOH A . D 4 HOH 39 1040 39 HOH HOH A . D 4 HOH 40 1041 40 HOH HOH A . D 4 HOH 41 1042 41 HOH HOH A . D 4 HOH 42 1043 42 HOH HOH A . D 4 HOH 43 1044 43 HOH HOH A . D 4 HOH 44 1045 44 HOH HOH A . D 4 HOH 45 1046 45 HOH HOH A . D 4 HOH 46 1047 46 HOH HOH A . D 4 HOH 47 1048 47 HOH HOH A . D 4 HOH 48 1049 48 HOH HOH A . D 4 HOH 49 1050 49 HOH HOH A . D 4 HOH 50 1051 50 HOH HOH A . D 4 HOH 51 1052 51 HOH HOH A . D 4 HOH 52 1053 52 HOH HOH A . D 4 HOH 53 1054 53 HOH HOH A . D 4 HOH 54 1055 54 HOH HOH A . D 4 HOH 55 1056 55 HOH HOH A . D 4 HOH 56 1057 56 HOH HOH A . D 4 HOH 57 1058 57 HOH HOH A . D 4 HOH 58 1059 58 HOH HOH A . D 4 HOH 59 1060 59 HOH HOH A . D 4 HOH 60 1061 60 HOH HOH A . D 4 HOH 61 1062 61 HOH HOH A . D 4 HOH 62 1063 62 HOH HOH A . D 4 HOH 63 1064 63 HOH HOH A . D 4 HOH 64 1065 64 HOH HOH A . D 4 HOH 65 1066 65 HOH HOH A . D 4 HOH 66 1067 66 HOH HOH A . D 4 HOH 67 1068 67 HOH HOH A . D 4 HOH 68 1069 68 HOH HOH A . D 4 HOH 69 1070 69 HOH HOH A . D 4 HOH 70 1071 70 HOH HOH A . D 4 HOH 71 1072 71 HOH HOH A . D 4 HOH 72 1073 72 HOH HOH A . D 4 HOH 73 1074 73 HOH HOH A . D 4 HOH 74 1075 74 HOH HOH A . D 4 HOH 75 1076 75 HOH HOH A . D 4 HOH 76 1077 76 HOH HOH A . D 4 HOH 77 1078 77 HOH HOH A . D 4 HOH 78 1079 78 HOH HOH A . D 4 HOH 79 1080 79 HOH HOH A . D 4 HOH 80 1081 80 HOH HOH A . D 4 HOH 81 1082 81 HOH HOH A . D 4 HOH 82 1083 82 HOH HOH A . D 4 HOH 83 1084 83 HOH HOH A . D 4 HOH 84 1085 84 HOH HOH A . D 4 HOH 85 1086 85 HOH HOH A . D 4 HOH 86 1087 86 HOH HOH A . D 4 HOH 87 1088 87 HOH HOH A . D 4 HOH 88 1089 88 HOH HOH A . D 4 HOH 89 1090 89 HOH HOH A . D 4 HOH 90 1091 90 HOH HOH A . D 4 HOH 91 1092 91 HOH HOH A . D 4 HOH 92 1093 92 HOH HOH A . D 4 HOH 93 1094 93 HOH HOH A . D 4 HOH 94 1095 94 HOH HOH A . D 4 HOH 95 1096 95 HOH HOH A . D 4 HOH 96 1097 96 HOH HOH A . D 4 HOH 97 1098 97 HOH HOH A . D 4 HOH 98 1099 98 HOH HOH A . D 4 HOH 99 1100 99 HOH HOH A . D 4 HOH 100 1101 100 HOH HOH A . D 4 HOH 101 1102 101 HOH HOH A . D 4 HOH 102 1103 102 HOH HOH A . D 4 HOH 103 1104 103 HOH HOH A . D 4 HOH 104 1105 104 HOH HOH A . D 4 HOH 105 1106 105 HOH HOH A . D 4 HOH 106 1107 106 HOH HOH A . D 4 HOH 107 1108 107 HOH HOH A . D 4 HOH 108 1109 108 HOH HOH A . D 4 HOH 109 1110 109 HOH HOH A . D 4 HOH 110 1111 110 HOH HOH A . D 4 HOH 111 1112 111 HOH HOH A . D 4 HOH 112 1113 112 HOH HOH A . D 4 HOH 113 1114 113 HOH HOH A . D 4 HOH 114 1115 114 HOH HOH A . D 4 HOH 115 1116 115 HOH HOH A . D 4 HOH 116 1117 116 HOH HOH A . D 4 HOH 117 1118 117 HOH HOH A . D 4 HOH 118 1119 118 HOH HOH A . D 4 HOH 119 1120 119 HOH HOH A . D 4 HOH 120 1121 120 HOH HOH A . D 4 HOH 121 1122 121 HOH HOH A . D 4 HOH 122 1123 122 HOH HOH A . D 4 HOH 123 1124 123 HOH HOH A . D 4 HOH 124 1125 124 HOH HOH A . D 4 HOH 125 1126 125 HOH HOH A . D 4 HOH 126 1127 126 HOH HOH A . D 4 HOH 127 1128 127 HOH HOH A . D 4 HOH 128 1129 128 HOH HOH A . D 4 HOH 129 1130 129 HOH HOH A . D 4 HOH 130 1131 130 HOH HOH A . D 4 HOH 131 1132 131 HOH HOH A . D 4 HOH 132 1133 132 HOH HOH A . D 4 HOH 133 1134 133 HOH HOH A . D 4 HOH 134 1135 134 HOH HOH A . D 4 HOH 135 1136 135 HOH HOH A . D 4 HOH 136 1137 136 HOH HOH A . D 4 HOH 137 1138 137 HOH HOH A . D 4 HOH 138 1139 138 HOH HOH A . D 4 HOH 139 1140 139 HOH HOH A . D 4 HOH 140 1141 140 HOH HOH A . D 4 HOH 141 1142 141 HOH HOH A . D 4 HOH 142 1143 142 HOH HOH A . D 4 HOH 143 1144 143 HOH HOH A . D 4 HOH 144 1145 144 HOH HOH A . D 4 HOH 145 1146 145 HOH HOH A . D 4 HOH 146 1147 146 HOH HOH A . D 4 HOH 147 1148 147 HOH HOH A . D 4 HOH 148 1149 148 HOH HOH A . D 4 HOH 149 1150 149 HOH HOH A . D 4 HOH 150 1151 150 HOH HOH A . D 4 HOH 151 1152 151 HOH HOH A . D 4 HOH 152 1153 152 HOH HOH A . D 4 HOH 153 1154 153 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-04-25 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_ref_seq_dif 3 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 MOSFLM 'data reduction' . ? 2 CCP4 'data scaling' '(SCALA)' ? 3 AMoRE phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 81 ? ? -120.84 -114.21 2 1 ILE A 90 ? ? -131.27 -52.09 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 17 ? CG ? A LYS 17 CG 2 1 Y 1 A LYS 17 ? CD ? A LYS 17 CD 3 1 Y 1 A LYS 17 ? CE ? A LYS 17 CE 4 1 Y 1 A LYS 17 ? NZ ? A LYS 17 NZ 5 1 Y 1 A ARG 18 ? NH1 ? A ARG 18 NH1 6 1 Y 1 A ARG 18 ? NH2 ? A ARG 18 NH2 7 1 Y 1 A LYS 35 ? CD ? A LYS 35 CD 8 1 Y 1 A LYS 35 ? CE ? A LYS 35 CE 9 1 Y 1 A LYS 35 ? NZ ? A LYS 35 NZ 10 1 Y 1 A ARG 40 ? CG ? A ARG 40 CG 11 1 Y 1 A ARG 40 ? CD ? A ARG 40 CD 12 1 Y 1 A ARG 40 ? NE ? A ARG 40 NE 13 1 Y 1 A ARG 40 ? CZ ? A ARG 40 CZ 14 1 Y 1 A ARG 40 ? NH1 ? A ARG 40 NH1 15 1 Y 1 A ARG 40 ? NH2 ? A ARG 40 NH2 16 1 Y 1 A ASP 41 ? CG ? A ASP 41 CG 17 1 Y 1 A ASP 41 ? OD1 ? A ASP 41 OD1 18 1 Y 1 A ASP 41 ? OD2 ? A ASP 41 OD2 19 1 Y 1 A ARG 42 ? CG ? A ARG 42 CG 20 1 Y 1 A ARG 42 ? CD ? A ARG 42 CD 21 1 Y 1 A ARG 42 ? NE ? A ARG 42 NE 22 1 Y 1 A ARG 42 ? CZ ? A ARG 42 CZ 23 1 Y 1 A ARG 42 ? NH1 ? A ARG 42 NH1 24 1 Y 1 A ARG 42 ? NH2 ? A ARG 42 NH2 25 1 Y 1 A LYS 44 ? CG ? A LYS 44 CG 26 1 Y 1 A LYS 44 ? CD ? A LYS 44 CD 27 1 Y 1 A LYS 44 ? CE ? A LYS 44 CE 28 1 Y 1 A LYS 44 ? NZ ? A LYS 44 NZ 29 1 Y 1 A LYS 105 ? CD ? A LYS 105 CD 30 1 Y 1 A LYS 105 ? CE ? A LYS 105 CE 31 1 Y 1 A LYS 105 ? NZ ? A LYS 105 NZ # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'RAPAMYCIN IMMUNOSUPPRESSANT DRUG' RAP 3 GLYCEROL GOL 4 water HOH #