data_2DPW # _entry.id 2DPW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2DPW RCSB RCSB025701 WWPDB D_1000025701 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ttk003001858.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2DPW _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2006-05-17 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rehse, P.H.' 1 'Yokoyama, S.' 2 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 3 # _citation.id primary _citation.title 'Hypothetical Transferase from Thermus thermophilus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Rehse, P.H.' 1 primary 'Yokoyama, S.' 2 # _cell.length_a 76.190 _cell.length_b 76.190 _cell.length_c 196.980 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 2DPW _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.entry_id 2DPW _symmetry.Int_Tables_number 178 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein TTHA0179' 25489.451 1 ? ? ? ? 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 water nat water 18.015 30 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)RPSAIVLAGGKEAWAERFGVGSKALVPYRGRP(MSE)VEWVLEALYAAGLSPVYVGENPGLVPAPALTLPDRGGL LENLEQALEHVEGRVLVATGDIPHLTEEAVRFVLDKAPEAALVYPIVPKEAVEARFPRTKRTYARLREGTFTGGNLLLLD KSLFRKALPLARRVVALRKRPLALARLVGWDVLLKLLLGRLSLAEVEARAQRILGVEARALVTPYPEVGVDVDREEDLVS ; _entity_poly.pdbx_seq_one_letter_code_can ;MRPSAIVLAGGKEAWAERFGVGSKALVPYRGRPMVEWVLEALYAAGLSPVYVGENPGLVPAPALTLPDRGGLLENLEQAL EHVEGRVLVATGDIPHLTEEAVRFVLDKAPEAALVYPIVPKEAVEARFPRTKRTYARLREGTFTGGNLLLLDKSLFRKAL PLARRVVALRKRPLALARLVGWDVLLKLLLGRLSLAEVEARAQRILGVEARALVTPYPEVGVDVDREEDLVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003001858.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ARG n 1 3 PRO n 1 4 SER n 1 5 ALA n 1 6 ILE n 1 7 VAL n 1 8 LEU n 1 9 ALA n 1 10 GLY n 1 11 GLY n 1 12 LYS n 1 13 GLU n 1 14 ALA n 1 15 TRP n 1 16 ALA n 1 17 GLU n 1 18 ARG n 1 19 PHE n 1 20 GLY n 1 21 VAL n 1 22 GLY n 1 23 SER n 1 24 LYS n 1 25 ALA n 1 26 LEU n 1 27 VAL n 1 28 PRO n 1 29 TYR n 1 30 ARG n 1 31 GLY n 1 32 ARG n 1 33 PRO n 1 34 MSE n 1 35 VAL n 1 36 GLU n 1 37 TRP n 1 38 VAL n 1 39 LEU n 1 40 GLU n 1 41 ALA n 1 42 LEU n 1 43 TYR n 1 44 ALA n 1 45 ALA n 1 46 GLY n 1 47 LEU n 1 48 SER n 1 49 PRO n 1 50 VAL n 1 51 TYR n 1 52 VAL n 1 53 GLY n 1 54 GLU n 1 55 ASN n 1 56 PRO n 1 57 GLY n 1 58 LEU n 1 59 VAL n 1 60 PRO n 1 61 ALA n 1 62 PRO n 1 63 ALA n 1 64 LEU n 1 65 THR n 1 66 LEU n 1 67 PRO n 1 68 ASP n 1 69 ARG n 1 70 GLY n 1 71 GLY n 1 72 LEU n 1 73 LEU n 1 74 GLU n 1 75 ASN n 1 76 LEU n 1 77 GLU n 1 78 GLN n 1 79 ALA n 1 80 LEU n 1 81 GLU n 1 82 HIS n 1 83 VAL n 1 84 GLU n 1 85 GLY n 1 86 ARG n 1 87 VAL n 1 88 LEU n 1 89 VAL n 1 90 ALA n 1 91 THR n 1 92 GLY n 1 93 ASP n 1 94 ILE n 1 95 PRO n 1 96 HIS n 1 97 LEU n 1 98 THR n 1 99 GLU n 1 100 GLU n 1 101 ALA n 1 102 VAL n 1 103 ARG n 1 104 PHE n 1 105 VAL n 1 106 LEU n 1 107 ASP n 1 108 LYS n 1 109 ALA n 1 110 PRO n 1 111 GLU n 1 112 ALA n 1 113 ALA n 1 114 LEU n 1 115 VAL n 1 116 TYR n 1 117 PRO n 1 118 ILE n 1 119 VAL n 1 120 PRO n 1 121 LYS n 1 122 GLU n 1 123 ALA n 1 124 VAL n 1 125 GLU n 1 126 ALA n 1 127 ARG n 1 128 PHE n 1 129 PRO n 1 130 ARG n 1 131 THR n 1 132 LYS n 1 133 ARG n 1 134 THR n 1 135 TYR n 1 136 ALA n 1 137 ARG n 1 138 LEU n 1 139 ARG n 1 140 GLU n 1 141 GLY n 1 142 THR n 1 143 PHE n 1 144 THR n 1 145 GLY n 1 146 GLY n 1 147 ASN n 1 148 LEU n 1 149 LEU n 1 150 LEU n 1 151 LEU n 1 152 ASP n 1 153 LYS n 1 154 SER n 1 155 LEU n 1 156 PHE n 1 157 ARG n 1 158 LYS n 1 159 ALA n 1 160 LEU n 1 161 PRO n 1 162 LEU n 1 163 ALA n 1 164 ARG n 1 165 ARG n 1 166 VAL n 1 167 VAL n 1 168 ALA n 1 169 LEU n 1 170 ARG n 1 171 LYS n 1 172 ARG n 1 173 PRO n 1 174 LEU n 1 175 ALA n 1 176 LEU n 1 177 ALA n 1 178 ARG n 1 179 LEU n 1 180 VAL n 1 181 GLY n 1 182 TRP n 1 183 ASP n 1 184 VAL n 1 185 LEU n 1 186 LEU n 1 187 LYS n 1 188 LEU n 1 189 LEU n 1 190 LEU n 1 191 GLY n 1 192 ARG n 1 193 LEU n 1 194 SER n 1 195 LEU n 1 196 ALA n 1 197 GLU n 1 198 VAL n 1 199 GLU n 1 200 ALA n 1 201 ARG n 1 202 ALA n 1 203 GLN n 1 204 ARG n 1 205 ILE n 1 206 LEU n 1 207 GLY n 1 208 VAL n 1 209 GLU n 1 210 ALA n 1 211 ARG n 1 212 ALA n 1 213 LEU n 1 214 VAL n 1 215 THR n 1 216 PRO n 1 217 TYR n 1 218 PRO n 1 219 GLU n 1 220 VAL n 1 221 GLY n 1 222 VAL n 1 223 ASP n 1 224 VAL n 1 225 ASP n 1 226 ARG n 1 227 GLU n 1 228 GLU n 1 229 ASP n 1 230 LEU n 1 231 VAL n 1 232 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Thermus thermophilus' _entity_src_gen.gene_src_strain HB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300852 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta834 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5SLW4_THET8 _struct_ref.pdbx_db_accession Q5SLW4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRPSAIVLAGGKEAWAERFGVGSKALVPYRGRPMVEWVLEALYAAGLSPVYVGENPGLVPAPALTLPDRGGLLENLEQAL EHVEGRVLVATGDIPHLTEEAVRFVLDKAPEAALVYPIVPKEAVEARFPRTKRTYARLREGTFTGGNLLLLDKSLFRKAL PLARRVVALRKRPLALARLVGWDVLLKLLLGRLSLAEVEARAQRILGVEARALVTPYPEVGVDVDREEDLVS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2DPW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 232 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5SLW4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 232 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 232 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2DPW MSE A 1 ? UNP Q5SLW4 MET 1 'MODIFIED RESIDUE' 1 1 1 2DPW MSE A 34 ? UNP Q5SLW4 MET 34 'MODIFIED RESIDUE' 34 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2DPW _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.24 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 61.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.pH 5.2 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'Lithium sulfate 1.2M, Sodium Acetate 0.1M, pH 5.2, VAPOR DIFFUSION, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2006-03-14 _diffrn_detector.details Mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.monochromator Si111 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97894 1.0 2 0.97933 1.0 3 1.0000 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97894, 0.97933, 1.0000' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 # _reflns.entry_id 2DPW _reflns.d_resolution_high 2.900 _reflns.d_resolution_low 38.09 _reflns.number_obs 8150 _reflns.percent_possible_obs 100.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.number_all 8150 _reflns.pdbx_Rmerge_I_obs 0.084 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 25.8 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 19.05 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 3.00 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all 16205 _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.331 _reflns_shell.meanI_over_sigI_obs 10.1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.percent_possible_all 100.00 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 20.21 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2DPW _refine.ls_d_res_high 2.900 _refine.ls_d_res_low 38.090 _refine.ls_percent_reflns_obs 100.000 _refine.ls_number_reflns_obs 8101 _refine.ls_R_factor_R_work 0.226 _refine.ls_R_factor_R_free 0.281 _refine.ls_percent_reflns_R_free 5.400 _refine.ls_number_reflns_R_free 441 _refine.B_iso_mean 55.333 _refine.solvent_model_param_bsol 48.158 _refine.aniso_B[1][1] -3.342 _refine.aniso_B[2][2] -15.313 _refine.aniso_B[3][3] 18.655 _refine.aniso_B[1][2] -5.193 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.overall_FOM_work_R_set 0.784 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 8101 _refine.ls_R_factor_all 0.226 _refine.ls_R_factor_obs 0.226 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model isotropic _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2DPW _refine_analyze.Luzzati_coordinate_error_obs 0.34 _refine_analyze.Luzzati_sigma_a_obs 0.39 _refine_analyze.Luzzati_d_res_low_obs 5.0 _refine_analyze.Luzzati_coordinate_error_free 0.48 _refine_analyze.Luzzati_sigma_a_free 0.60 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1785 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1816 _refine_hist.d_res_high 2.900 _refine_hist.d_res_low 38.090 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_mcbond_it ? 4.917 1.500 ? 'X-RAY DIFFRACTION' ? c_scbond_it ? 8.092 2.000 ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? 7.099 2.000 ? 'X-RAY DIFFRACTION' ? c_scangle_it ? 10.356 2.500 ? 'X-RAY DIFFRACTION' ? c_bond_d ? 0.008161 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 1.58114 ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? 23.83781 ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? 1.10963 ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 2.900 3.030 . 916 . 0.31 0.378 . 59 . . 975 8 . 'X-RAY DIFFRACTION' 3.030 3.190 . 936 . 0.254 0.359 . 52 . . 988 8 . 'X-RAY DIFFRACTION' 3.190 3.390 . 930 . 0.223 0.277 . 43 . . 973 8 . 'X-RAY DIFFRACTION' 3.390 3.650 . 952 . 0.23 0.275 . 46 . . 998 8 . 'X-RAY DIFFRACTION' 3.650 4.020 . 943 . 0.217 0.26 . 55 . . 998 8 . 'X-RAY DIFFRACTION' 4.020 4.600 . 948 . 0.216 0.316 . 50 . . 998 8 . 'X-RAY DIFFRACTION' 4.600 5.790 . 977 . 0.209 0.229 . 65 . . 1042 8 . 'X-RAY DIFFRACTION' 5.790 38.090 . 1058 . 0.244 0.286 . 71 . . 1129 8 . 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 CNS_TOPPAR:protein_rep.param ? 'X-RAY DIFFRACTION' 2 CNS_TOPPAR:water_rep.param ? 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:ion.param ? 'X-RAY DIFFRACTION' 4 cis_peptide.param ? 'X-RAY DIFFRACTION' # _struct.entry_id 2DPW _struct.title 'Hpothetical Transferase Structure from Thermus thermophilus' _struct.pdbx_descriptor 'Hypothetical protein TTHA0179' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2DPW _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Transferase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 14 ? ARG A 18 ? ALA A 14 ARG A 18 5 ? 5 HELX_P HELX_P2 2 SER A 23 ? LEU A 26 ? SER A 23 LEU A 26 5 ? 4 HELX_P HELX_P3 3 MSE A 34 ? ALA A 45 ? MSE A 34 ALA A 45 1 ? 12 HELX_P HELX_P4 4 GLY A 71 ? HIS A 82 ? GLY A 71 HIS A 82 1 ? 12 HELX_P HELX_P5 5 THR A 98 ? ALA A 109 ? THR A 98 ALA A 109 1 ? 12 HELX_P HELX_P6 6 LYS A 121 ? PHE A 128 ? LYS A 121 PHE A 128 1 ? 8 HELX_P HELX_P7 7 LYS A 153 ? ARG A 157 ? LYS A 153 ARG A 157 1 ? 5 HELX_P HELX_P8 8 ALA A 159 ? LEU A 169 ? ALA A 159 LEU A 169 1 ? 11 HELX_P HELX_P9 9 ARG A 172 ? GLY A 181 ? ARG A 172 GLY A 181 1 ? 10 HELX_P HELX_P10 10 GLY A 181 ? LEU A 190 ? GLY A 181 LEU A 190 1 ? 10 HELX_P HELX_P11 11 SER A 194 ? GLY A 207 ? SER A 194 GLY A 207 1 ? 14 HELX_P HELX_P12 12 TYR A 217 ? GLY A 221 ? TYR A 217 GLY A 221 5 ? 5 HELX_P HELX_P13 13 ARG A 226 ? VAL A 231 ? ARG A 226 VAL A 231 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A ARG 2 N ? ? A MSE 1 A ARG 2 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? A PRO 33 C ? ? ? 1_555 A MSE 34 N ? ? A PRO 33 A MSE 34 1_555 ? ? ? ? ? ? ? 1.321 ? covale3 covale ? ? A MSE 34 C ? ? ? 1_555 A VAL 35 N ? ? A MSE 34 A VAL 35 1_555 ? ? ? ? ? ? ? 1.329 ? metalc1 metalc ? ? B NA . NA ? ? ? 1_555 A ARG 178 NH2 ? ? A NA 233 A ARG 178 1_555 ? ? ? ? ? ? ? 2.578 ? metalc2 metalc ? ? B NA . NA ? ? ? 1_555 A ARG 172 NH2 ? ? A NA 233 A ARG 172 12_566 ? ? ? ? ? ? ? 2.451 ? metalc3 metalc ? ? B NA . NA ? ? ? 1_555 C HOH . O ? ? A NA 233 A HOH 234 12_566 ? ? ? ? ? ? ? 2.556 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 59 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 59 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 60 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 60 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.65 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 7 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 64 ? LEU A 66 ? LEU A 64 LEU A 66 A 2 SER A 48 ? VAL A 52 ? SER A 48 VAL A 52 A 3 SER A 4 ? LEU A 8 ? SER A 4 LEU A 8 A 4 ARG A 86 ? THR A 91 ? ARG A 86 THR A 91 A 5 LEU A 148 ? ASP A 152 ? LEU A 148 ASP A 152 A 6 LEU A 114 ? PRO A 120 ? LEU A 114 PRO A 120 A 7 GLY A 141 ? GLY A 145 ? GLY A 141 GLY A 145 A 8 ALA A 136 ? LEU A 138 ? ALA A 136 LEU A 138 B 1 LEU A 64 ? LEU A 66 ? LEU A 64 LEU A 66 B 2 SER A 48 ? VAL A 52 ? SER A 48 VAL A 52 B 3 SER A 4 ? LEU A 8 ? SER A 4 LEU A 8 B 4 ARG A 86 ? THR A 91 ? ARG A 86 THR A 91 B 5 LEU A 148 ? ASP A 152 ? LEU A 148 ASP A 152 B 6 LEU A 114 ? PRO A 120 ? LEU A 114 PRO A 120 B 7 ALA A 210 ? VAL A 214 ? ALA A 210 VAL A 214 C 1 PRO A 28 ? TYR A 29 ? PRO A 28 TYR A 29 C 2 ARG A 32 ? PRO A 33 ? ARG A 32 PRO A 33 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 64 ? O LEU A 64 N TYR A 51 ? N TYR A 51 A 2 3 O VAL A 50 ? O VAL A 50 N VAL A 7 ? N VAL A 7 A 3 4 N LEU A 8 ? N LEU A 8 O ALA A 90 ? O ALA A 90 A 4 5 N VAL A 87 ? N VAL A 87 O LEU A 151 ? O LEU A 151 A 5 6 O LEU A 150 ? O LEU A 150 N VAL A 115 ? N VAL A 115 A 6 7 N VAL A 119 ? N VAL A 119 O THR A 144 ? O THR A 144 A 7 8 O GLY A 141 ? O GLY A 141 N LEU A 138 ? N LEU A 138 B 1 2 O LEU A 64 ? O LEU A 64 N TYR A 51 ? N TYR A 51 B 2 3 O VAL A 50 ? O VAL A 50 N VAL A 7 ? N VAL A 7 B 3 4 N LEU A 8 ? N LEU A 8 O ALA A 90 ? O ALA A 90 B 4 5 N VAL A 87 ? N VAL A 87 O LEU A 151 ? O LEU A 151 B 5 6 O LEU A 150 ? O LEU A 150 N VAL A 115 ? N VAL A 115 B 6 7 N TYR A 116 ? N TYR A 116 O ARG A 211 ? O ARG A 211 C 1 2 N TYR A 29 ? N TYR A 29 O ARG A 32 ? O ARG A 32 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE NA A 233' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 172 ? ARG A 172 . ? 12_566 ? 2 AC1 4 ALA A 175 ? ALA A 175 . ? 12_566 ? 3 AC1 4 ARG A 178 ? ARG A 178 . ? 1_555 ? 4 AC1 4 HOH C . ? HOH A 234 . ? 12_566 ? # _atom_sites.entry_id 2DPW _atom_sites.fract_transf_matrix[1][1] 0.013125 _atom_sites.fract_transf_matrix[1][2] 0.007578 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015156 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005077 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 MSE 34 34 34 MSE MSE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 TRP 182 182 182 TRP TRP A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 ALA 212 212 212 ALA ALA A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 ARG 226 226 226 ARG ARG A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 SER 232 232 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 34 A MSE 34 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NH2 ? A ARG 178 ? A ARG 178 ? 1_555 NA ? B NA . ? A NA 233 ? 1_555 NH2 ? A ARG 172 ? A ARG 172 ? 12_566 114.3 ? 2 NH2 ? A ARG 178 ? A ARG 178 ? 1_555 NA ? B NA . ? A NA 233 ? 1_555 O ? C HOH . ? A HOH 234 ? 12_566 136.1 ? 3 NH2 ? A ARG 172 ? A ARG 172 ? 12_566 NA ? B NA . ? A NA 233 ? 1_555 O ? C HOH . ? A HOH 234 ? 12_566 108.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-22 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 2.900 _diffrn_reflns.pdbx_d_res_low 39.650 _diffrn_reflns.pdbx_number_obs 8201 _diffrn_reflns.pdbx_Rmerge_I_obs 0.081 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared 0.95 _diffrn_reflns.av_sigmaI_over_netI 26.00 _diffrn_reflns.pdbx_redundancy 19.34 _diffrn_reflns.pdbx_percent_possible_obs 99.90 _diffrn_reflns.number 159800 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 6.24 39.65 ? 405 0.046 ? 0.890 15.58 99.00 1 4.96 6.24 ? 108 0.059 ? 0.860 18.57 100.00 1 4.33 4.96 ? 143 0.055 ? 0.870 19.19 100.00 1 3.94 4.33 ? 134 0.063 ? 0.860 19.57 100.00 1 3.65 3.94 ? 117 0.087 ? 0.910 19.70 100.00 1 3.44 3.65 ? 88 0.116 ? 0.950 20.02 100.00 1 3.27 3.44 ? 65 0.153 ? 0.970 20.21 100.00 1 3.12 3.27 ? 59 0.210 ? 1.030 20.23 100.00 1 3.00 3.12 ? 62 0.269 ? 1.060 20.39 100.00 1 2.90 3.00 ? 18 0.344 ? 1.050 20.59 100.00 # loop_ _pdbx_phasing_MAD_set_site.id _pdbx_phasing_MAD_set_site.atom_type_symbol _pdbx_phasing_MAD_set_site.occupancy _pdbx_phasing_MAD_set_site.fract_x _pdbx_phasing_MAD_set_site.fract_y _pdbx_phasing_MAD_set_site.fract_z _pdbx_phasing_MAD_set_site.b_iso 1 Se 0.800 0.018 0.440 0.036 51.543 2 Se 0.349 0.723 0.943 0.031 60.000 # _pdbx_phasing_dm.entry_id 2DPW _pdbx_phasing_dm.fom_acentric 0.680 _pdbx_phasing_dm.fom_centric 0.690 _pdbx_phasing_dm.fom 0.680 _pdbx_phasing_dm.reflns_acentric 6157 _pdbx_phasing_dm.reflns_centric 2021 _pdbx_phasing_dm.reflns 8178 # loop_ _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.delta_phi_final _pdbx_phasing_dm_shell.delta_phi_initial _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 2.900 3.100 ? ? 0.370 0.330 0.360 1210 257 1467 3.100 3.600 ? ? 0.590 0.570 0.590 1924 474 2398 3.600 4.100 ? ? 0.800 0.690 0.770 1049 314 1363 4.100 5.200 ? ? 0.880 0.820 0.870 1022 357 1379 5.200 8.300 ? ? 0.900 0.830 0.870 760 391 1151 8.300 39.465 ? ? 0.950 0.880 0.910 192 228 420 # _phasing.method MAD # _phasing_MAD_clust.id 1 _phasing_MAD_clust.expt_id '3 wavelength' _phasing_MAD_clust.number_set ? # _phasing_MAD_expt.id '3 wavelength' _phasing_MAD_expt.mean_fom ? # loop_ _phasing_MAD_set.clust_id _phasing_MAD_set.expt_id _phasing_MAD_set.set_id _phasing_MAD_set.wavelength _phasing_MAD_set.pdbx_f_prime_refined _phasing_MAD_set.pdbx_f_double_prime_refined 1 '3 wavelength' 1 0.9789 -8.80 4.29 1 '3 wavelength' 2 0.9793 -8.38 2.32 1 '3 wavelength' 3 1.0000 -3.86 0.50 # loop_ _phasing_set.id _phasing_set.pdbx_d_res_high _phasing_set.pdbx_d_res_low 1 . . 2 . . 3 . . # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal d*TREK 8.0SSI 'Oct 31 2003' package 'Pflugrath, J.W.' jwp@RigakuMSC.com 'data scaling' http://www.msc.com/protein/dtrek.html ? ? 1 SOLVE 2.10 8-Jun-2005 package 'Tom Terwilliger' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 2 RESOLVE 2.10 09-Aug-2005 package 'Terwilliger, T. C' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 3 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 4 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 5 CrystalClear . ? ? ? ? 'data reduction' ? ? ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 14 ? ? -65.71 -78.03 2 1 MSE A 34 ? ? -21.11 -51.46 3 1 PHE A 128 ? ? -103.53 48.32 4 1 PRO A 129 ? ? -33.72 -36.24 5 1 THR A 131 ? ? -36.45 119.59 6 1 ARG A 157 ? ? -28.01 -44.50 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id SER _pdbx_unobs_or_zero_occ_residues.auth_seq_id 232 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id SER _pdbx_unobs_or_zero_occ_residues.label_seq_id 232 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 233 101 NA NA A . C 3 HOH 1 234 1 HOH HOH A . C 3 HOH 2 235 2 HOH HOH A . C 3 HOH 3 236 3 HOH HOH A . C 3 HOH 4 237 4 HOH HOH A . C 3 HOH 5 238 5 HOH HOH A . C 3 HOH 6 239 6 HOH HOH A . C 3 HOH 7 240 7 HOH HOH A . C 3 HOH 8 241 8 HOH HOH A . C 3 HOH 9 242 9 HOH HOH A . C 3 HOH 10 243 10 HOH HOH A . C 3 HOH 11 244 11 HOH HOH A . C 3 HOH 12 245 12 HOH HOH A . C 3 HOH 13 246 13 HOH HOH A . C 3 HOH 14 247 14 HOH HOH A . C 3 HOH 15 248 15 HOH HOH A . C 3 HOH 16 249 16 HOH HOH A . C 3 HOH 17 250 17 HOH HOH A . C 3 HOH 18 251 18 HOH HOH A . C 3 HOH 19 252 19 HOH HOH A . C 3 HOH 20 253 20 HOH HOH A . C 3 HOH 21 254 21 HOH HOH A . C 3 HOH 22 255 22 HOH HOH A . C 3 HOH 23 256 23 HOH HOH A . C 3 HOH 24 257 24 HOH HOH A . C 3 HOH 25 258 25 HOH HOH A . C 3 HOH 26 259 26 HOH HOH A . C 3 HOH 27 260 27 HOH HOH A . C 3 HOH 28 261 28 HOH HOH A . C 3 HOH 29 262 29 HOH HOH A . C 3 HOH 30 263 30 HOH HOH A . #