data_2E8P # _entry.id 2E8P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2E8P pdb_00002e8p 10.2210/pdb2e8p/pdb RCSB RCSB026365 ? ? WWPDB D_1000026365 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001002151.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2E8P _pdbx_database_status.recvd_initial_deposition_date 2007-01-22 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goroncy, A.K.' 1 'Sato, M.' 2 'Koshiba, S.' 3 'Watanabe, S.' 4 'Harada, T.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the N-terminal SAM-domain of E74-like factor 3' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Goroncy, A.K.' 1 ? primary 'Sato, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Watanabe, S.' 4 ? primary 'Harada, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _cell.entry_id 2E8P _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2E8P _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ELF3 protein' _entity.formula_weight 10130.163 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SAM domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'E74-like factor 3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQ LHAQLRDLTSSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQ LHAQLRDLTSSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001002151.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 MET n 1 10 SER n 1 11 LEU n 1 12 GLU n 1 13 GLY n 1 14 THR n 1 15 GLU n 1 16 LYS n 1 17 ALA n 1 18 SER n 1 19 TRP n 1 20 LEU n 1 21 GLY n 1 22 GLU n 1 23 GLN n 1 24 PRO n 1 25 GLN n 1 26 PHE n 1 27 TRP n 1 28 SER n 1 29 LYS n 1 30 THR n 1 31 GLN n 1 32 VAL n 1 33 LEU n 1 34 ASP n 1 35 TRP n 1 36 ILE n 1 37 SER n 1 38 TYR n 1 39 GLN n 1 40 VAL n 1 41 GLU n 1 42 LYS n 1 43 ASN n 1 44 LYS n 1 45 TYR n 1 46 ASP n 1 47 ALA n 1 48 SER n 1 49 ALA n 1 50 ILE n 1 51 ASP n 1 52 PHE n 1 53 SER n 1 54 ARG n 1 55 CYS n 1 56 ASP n 1 57 MET n 1 58 ASP n 1 59 GLY n 1 60 ALA n 1 61 THR n 1 62 LEU n 1 63 CYS n 1 64 ASN n 1 65 CYS n 1 66 ALA n 1 67 LEU n 1 68 GLU n 1 69 GLU n 1 70 LEU n 1 71 ARG n 1 72 LEU n 1 73 VAL n 1 74 PHE n 1 75 GLY n 1 76 PRO n 1 77 LEU n 1 78 GLY n 1 79 ASP n 1 80 GLN n 1 81 LEU n 1 82 HIS n 1 83 ALA n 1 84 GLN n 1 85 LEU n 1 86 ARG n 1 87 ASP n 1 88 LEU n 1 89 THR n 1 90 SER n 1 91 SER n 1 92 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ELF3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060313-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'CELL-FREE PROTEIN SYNTHESIS' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6IAP8_HUMAN _struct_ref.pdbx_db_accession Q6IAP8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRD LTSSS ; _struct_ref.pdbx_align_begin 48 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2E8P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6IAP8 _struct_ref_seq.db_align_beg 48 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2E8P GLY A 1 ? UNP Q6IAP8 ? ? 'cloning artifact' 1 1 1 2E8P SER A 2 ? UNP Q6IAP8 ? ? 'cloning artifact' 2 2 1 2E8P SER A 3 ? UNP Q6IAP8 ? ? 'cloning artifact' 3 3 1 2E8P GLY A 4 ? UNP Q6IAP8 ? ? 'cloning artifact' 4 4 1 2E8P SER A 5 ? UNP Q6IAP8 ? ? 'cloning artifact' 5 5 1 2E8P SER A 6 ? UNP Q6IAP8 ? ? 'cloning artifact' 6 6 1 2E8P GLY A 7 ? UNP Q6IAP8 ? ? 'cloning artifact' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.18mM SAM DOMAIN, 20mM d-TRIS-HCL, 100mM NaCl, 1mM d-DTT, 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2E8P _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2E8P _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2E8P _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 2.2.2 'P.GUNTERT ET AL.' 1 'structure solution' CYANA 2.2.2 'P.GUNTERT ET AL.' 2 collection XwinNMR 3.5 BRUKER 3 processing NMRPipe 20060524 'FRANK DELAGLIO' 4 'data analysis' NMRView 5.0.4 'BRUCE A. JOHNSON' 5 'data analysis' KUJIRA 0.899a 'NAOHIRO KOBAYASHI' 6 # _exptl.entry_id 2E8P _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2E8P _struct.title 'Solution structure of the N-terminal SAM-domain of E74-like factor 3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2E8P _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 23 ? TRP A 27 ? GLN A 23 TRP A 27 5 ? 5 HELX_P HELX_P2 2 SER A 28 ? ASN A 43 ? SER A 28 ASN A 43 1 ? 16 HELX_P HELX_P3 3 GLY A 59 ? CYS A 65 ? GLY A 59 CYS A 65 1 ? 7 HELX_P HELX_P4 4 ALA A 66 ? PHE A 74 ? ALA A 66 PHE A 74 1 ? 9 HELX_P HELX_P5 5 LEU A 77 ? SER A 91 ? LEU A 77 SER A 91 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2E8P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2E8P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 SER 92 92 92 SER SER A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 52.64 70.97 2 1 SER A 6 ? ? -170.43 142.31 3 1 GLN A 8 ? ? -117.93 55.64 4 1 MET A 9 ? ? -178.66 112.24 5 1 SER A 10 ? ? 57.27 91.89 6 1 GLU A 15 ? ? -142.21 35.15 7 1 LYS A 16 ? ? 61.24 -178.08 8 1 ALA A 49 ? ? -137.02 -42.29 9 1 SER A 91 ? ? 60.36 -172.38 10 2 SER A 6 ? ? -167.51 -46.10 11 2 SER A 10 ? ? -148.96 59.67 12 2 ALA A 49 ? ? -133.81 -40.41 13 2 SER A 91 ? ? 54.16 80.59 14 3 SER A 6 ? ? 61.81 174.81 15 3 LEU A 11 ? ? -147.34 50.65 16 3 GLU A 12 ? ? -96.65 -69.68 17 3 LYS A 16 ? ? 62.09 -172.90 18 3 ALA A 49 ? ? -135.79 -40.89 19 3 ASP A 56 ? ? -108.93 68.24 20 3 CYS A 65 ? ? -58.08 179.74 21 3 SER A 90 ? ? -53.08 103.45 22 3 SER A 91 ? ? 59.46 178.04 23 4 GLN A 8 ? ? -171.09 141.58 24 4 MET A 9 ? ? -173.07 67.11 25 4 LYS A 16 ? ? 61.18 178.90 26 4 ALA A 49 ? ? -134.06 -40.60 27 4 ASP A 51 ? ? -107.99 76.78 28 4 CYS A 55 ? ? -99.14 58.95 29 5 SER A 6 ? ? -99.36 -63.65 30 5 GLN A 8 ? ? 60.10 91.60 31 5 SER A 10 ? ? 59.20 -179.99 32 5 ALA A 49 ? ? -137.74 -41.42 33 5 ASP A 56 ? ? -107.24 68.41 34 5 THR A 89 ? ? -72.88 -72.32 35 5 SER A 91 ? ? 59.42 -177.25 36 6 SER A 6 ? ? -172.39 145.38 37 6 MET A 9 ? ? 53.53 -170.95 38 6 SER A 10 ? ? 58.30 178.04 39 6 LEU A 11 ? ? -165.98 59.73 40 6 GLU A 12 ? ? -160.90 89.31 41 6 GLU A 15 ? ? -147.06 28.57 42 6 ALA A 49 ? ? -137.18 -41.45 43 6 SER A 91 ? ? -102.80 44.11 44 7 SER A 5 ? ? -161.45 74.54 45 7 SER A 6 ? ? 57.55 -177.37 46 7 SER A 10 ? ? -155.47 30.06 47 7 ALA A 49 ? ? -145.29 -42.07 48 8 SER A 6 ? ? -152.43 39.37 49 8 MET A 9 ? ? -171.81 38.11 50 8 GLU A 12 ? ? -57.02 106.48 51 8 CYS A 55 ? ? -99.16 48.11 52 8 SER A 91 ? ? -168.28 49.26 53 9 SER A 2 ? ? -103.86 -63.82 54 9 SER A 6 ? ? 57.76 180.00 55 9 LYS A 16 ? ? 62.69 -170.99 56 9 ALA A 49 ? ? -138.91 -41.97 57 9 SER A 91 ? ? -170.83 136.83 58 10 MET A 9 ? ? 61.87 97.99 59 10 THR A 14 ? ? -176.49 143.24 60 10 ALA A 17 ? ? -171.94 137.58 61 10 ALA A 49 ? ? -132.25 -39.91 62 10 ASP A 56 ? ? -100.83 68.30 63 10 SER A 91 ? ? 55.97 -176.18 64 11 SER A 5 ? ? 55.83 88.23 65 11 SER A 6 ? ? -108.79 42.16 66 11 SER A 10 ? ? -144.82 -52.99 67 11 LEU A 11 ? ? 62.32 88.77 68 11 GLU A 15 ? ? 64.88 112.65 69 11 LYS A 16 ? ? -66.33 -170.93 70 11 ALA A 17 ? ? -171.85 137.38 71 11 ALA A 49 ? ? -134.31 -40.57 72 11 ILE A 50 ? ? -51.58 106.83 73 11 ASP A 51 ? ? -68.80 86.46 74 11 ASP A 56 ? ? -107.57 68.40 75 11 MET A 57 ? ? -129.84 -169.93 76 11 ASP A 58 ? ? -127.80 -57.55 77 11 SER A 90 ? ? 60.17 71.33 78 12 SER A 5 ? ? -130.96 -53.11 79 12 SER A 10 ? ? 61.98 96.99 80 12 GLU A 12 ? ? 62.91 178.80 81 12 LYS A 16 ? ? 62.12 178.83 82 12 ALA A 49 ? ? -134.31 -40.66 83 12 CYS A 55 ? ? -68.67 86.56 84 12 ASP A 58 ? ? -137.01 -48.54 85 12 SER A 90 ? ? 54.13 75.74 86 13 SER A 3 ? ? -172.37 142.14 87 13 SER A 5 ? ? 62.74 93.23 88 13 SER A 6 ? ? -169.02 45.67 89 13 GLN A 8 ? ? 61.30 101.00 90 13 MET A 9 ? ? -153.42 -55.09 91 13 SER A 10 ? ? -55.24 172.62 92 13 ALA A 49 ? ? -137.81 -41.48 93 13 PHE A 52 ? ? -91.29 46.50 94 13 SER A 53 ? ? -138.66 -42.11 95 14 SER A 6 ? ? -113.41 57.73 96 14 GLN A 8 ? ? 60.08 -173.27 97 14 LEU A 11 ? ? -111.70 60.78 98 14 LYS A 16 ? ? 57.16 -176.95 99 14 SER A 90 ? ? 58.87 95.42 100 15 SER A 2 ? ? 62.32 177.76 101 15 SER A 5 ? ? -154.39 27.34 102 15 GLN A 8 ? ? -160.09 118.62 103 15 MET A 9 ? ? -150.17 31.51 104 15 LYS A 16 ? ? 63.19 -176.09 105 15 ALA A 49 ? ? -134.93 -40.98 106 15 MET A 57 ? ? -69.76 -174.14 107 15 ASP A 58 ? ? -126.58 -52.25 108 15 SER A 91 ? ? 56.57 -177.70 109 16 SER A 2 ? ? -135.92 -71.31 110 16 GLN A 8 ? ? 54.98 82.48 111 16 LEU A 11 ? ? 59.95 173.77 112 16 LYS A 16 ? ? 57.38 -175.17 113 16 ALA A 49 ? ? -137.50 -41.43 114 16 PHE A 52 ? ? -91.78 45.69 115 16 SER A 53 ? ? -138.56 -42.04 116 16 SER A 91 ? ? 61.15 100.54 117 17 SER A 3 ? ? -173.61 -72.75 118 17 SER A 5 ? ? 61.36 65.30 119 17 MET A 9 ? ? -147.65 43.92 120 17 LYS A 16 ? ? 60.50 -179.90 121 17 ALA A 49 ? ? -134.64 -40.86 122 17 CYS A 55 ? ? -69.80 84.83 123 18 LYS A 16 ? ? 59.03 177.92 124 19 SER A 2 ? ? -154.55 -42.51 125 19 LYS A 16 ? ? 57.44 -177.85 126 20 SER A 2 ? ? 54.74 -172.89 127 20 GLU A 12 ? ? -129.88 -65.84 128 20 ALA A 17 ? ? -175.62 136.15 129 20 SER A 91 ? ? 62.75 166.44 #