data_2EPQ # _entry.id 2EPQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EPQ pdb_00002epq 10.2210/pdb2epq/pdb RCSB RCSB026955 ? ? WWPDB D_1000026955 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-12 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site 9 4 'Structure model' chem_comp_atom 10 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 3 'Structure model' '_struct_ref_seq_dif.details' 18 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EPQ _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002013231.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tanabe, W.' 1 'Suzuki, S.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Terada, T.' 6 'Shirouzu, M.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the third zinc finger domain of Zinc finger protein 278' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tanabe, W.' 1 ? primary 'Suzuki, S.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Terada, T.' 6 ? primary 'Shirouzu, M.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'POZ-, AT hook-, and zinc finger-containing protein 1' 4726.258 1 ? ? 'zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Zinc finger protein 278, Zinc finger sarcoma gene protein, BTB-POZ domain zinc finger transcription factor, Protein kinase A RI-subunit alpha- associated protein, Zinc finger and BTB domain-containing protein 19 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002013231.2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 LYS n 1 10 PRO n 1 11 TYR n 1 12 SER n 1 13 CYS n 1 14 PRO n 1 15 VAL n 1 16 CYS n 1 17 GLY n 1 18 LEU n 1 19 ARG n 1 20 PHE n 1 21 LYS n 1 22 ARG n 1 23 LYS n 1 24 ASP n 1 25 ARG n 1 26 MET n 1 27 SER n 1 28 TYR n 1 29 HIS n 1 30 VAL n 1 31 ARG n 1 32 SER n 1 33 HIS n 1 34 ASP n 1 35 GLY n 1 36 SER n 1 37 VAL n 1 38 GLY n 1 39 LYS n 1 40 SER n 1 41 GLY n 1 42 PRO n 1 43 SER n 1 44 SER n 1 45 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'PATZ1, PATZ, RIAZ, ZBTB19, ZNF278, ZSG' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061204-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 373 373 GLY GLY A . n A 1 2 SER 2 374 374 SER SER A . n A 1 3 SER 3 375 375 SER SER A . n A 1 4 GLY 4 376 376 GLY GLY A . n A 1 5 SER 5 377 377 SER SER A . n A 1 6 SER 6 378 378 SER SER A . n A 1 7 GLY 7 379 379 GLY GLY A . n A 1 8 GLU 8 380 380 GLU GLU A . n A 1 9 LYS 9 381 381 LYS LYS A . n A 1 10 PRO 10 382 382 PRO PRO A . n A 1 11 TYR 11 383 383 TYR TYR A . n A 1 12 SER 12 384 384 SER SER A . n A 1 13 CYS 13 385 385 CYS CYS A . n A 1 14 PRO 14 386 386 PRO PRO A . n A 1 15 VAL 15 387 387 VAL VAL A . n A 1 16 CYS 16 388 388 CYS CYS A . n A 1 17 GLY 17 389 389 GLY GLY A . n A 1 18 LEU 18 390 390 LEU LEU A . n A 1 19 ARG 19 391 391 ARG ARG A . n A 1 20 PHE 20 392 392 PHE PHE A . n A 1 21 LYS 21 393 393 LYS LYS A . n A 1 22 ARG 22 394 394 ARG ARG A . n A 1 23 LYS 23 395 395 LYS LYS A . n A 1 24 ASP 24 396 396 ASP ASP A . n A 1 25 ARG 25 397 397 ARG ARG A . n A 1 26 MET 26 398 398 MET MET A . n A 1 27 SER 27 399 399 SER SER A . n A 1 28 TYR 28 400 400 TYR TYR A . n A 1 29 HIS 29 401 401 HIS HIS A . n A 1 30 VAL 30 402 402 VAL VAL A . n A 1 31 ARG 31 403 403 ARG ARG A . n A 1 32 SER 32 404 404 SER SER A . n A 1 33 HIS 33 405 405 HIS HIS A . n A 1 34 ASP 34 406 406 ASP ASP A . n A 1 35 GLY 35 407 407 GLY GLY A . n A 1 36 SER 36 408 408 SER SER A . n A 1 37 VAL 37 409 409 VAL VAL A . n A 1 38 GLY 38 410 410 GLY GLY A . n A 1 39 LYS 39 411 411 LYS LYS A . n A 1 40 SER 40 412 412 SER SER A . n A 1 41 GLY 41 413 413 GLY GLY A . n A 1 42 PRO 42 414 414 PRO PRO A . n A 1 43 SER 43 415 415 SER SER A . n A 1 44 SER 44 416 416 SER SER A . n A 1 45 GLY 45 417 417 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 2EPQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EPQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EPQ _struct.title 'Solution structure of the third zinc finger domain of Zinc finger protein 278' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EPQ _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;C2H2, zinc finger domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PATZ1_HUMAN _struct_ref.pdbx_db_accession Q9HBE1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGK _struct_ref.pdbx_align_begin 380 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EPQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HBE1 _struct_ref_seq.db_align_beg 380 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 411 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 380 _struct_ref_seq.pdbx_auth_seq_align_end 411 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EPQ GLY A 1 ? UNP Q9HBE1 ? ? 'expression tag' 373 1 1 2EPQ SER A 2 ? UNP Q9HBE1 ? ? 'expression tag' 374 2 1 2EPQ SER A 3 ? UNP Q9HBE1 ? ? 'expression tag' 375 3 1 2EPQ GLY A 4 ? UNP Q9HBE1 ? ? 'expression tag' 376 4 1 2EPQ SER A 5 ? UNP Q9HBE1 ? ? 'expression tag' 377 5 1 2EPQ SER A 6 ? UNP Q9HBE1 ? ? 'expression tag' 378 6 1 2EPQ GLY A 7 ? UNP Q9HBE1 ? ? 'expression tag' 379 7 1 2EPQ SER A 40 ? UNP Q9HBE1 ? ? 'expression tag' 412 8 1 2EPQ GLY A 41 ? UNP Q9HBE1 ? ? 'expression tag' 413 9 1 2EPQ PRO A 42 ? UNP Q9HBE1 ? ? 'expression tag' 414 10 1 2EPQ SER A 43 ? UNP Q9HBE1 ? ? 'expression tag' 415 11 1 2EPQ SER A 44 ? UNP Q9HBE1 ? ? 'expression tag' 416 12 1 2EPQ GLY A 45 ? UNP Q9HBE1 ? ? 'expression tag' 417 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 22 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 34 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 394 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 406 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 13 SG ? ? A ZN 201 A CYS 385 1_555 ? ? ? ? ? ? ? 2.267 ? ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 16 SG ? ? A ZN 201 A CYS 388 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 29 NE2 ? ? A ZN 201 A HIS 401 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 33 NE2 ? ? A ZN 201 A HIS 405 1_555 ? ? ? ? ? ? ? 2.088 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 385 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 16 ? A CYS 388 ? 1_555 108.3 ? 2 SG ? A CYS 13 ? A CYS 385 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 29 ? A HIS 401 ? 1_555 112.4 ? 3 SG ? A CYS 16 ? A CYS 388 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 29 ? A HIS 401 ? 1_555 119.0 ? 4 SG ? A CYS 13 ? A CYS 385 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 405 ? 1_555 99.3 ? 5 SG ? A CYS 16 ? A CYS 388 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 405 ? 1_555 101.8 ? 6 NE2 ? A HIS 29 ? A HIS 401 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 405 ? 1_555 113.8 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 12 ? CYS A 13 ? SER A 384 CYS A 385 A 2 LEU A 18 ? ARG A 19 ? LEU A 390 ARG A 391 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 13 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 385 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 18 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 390 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 13 ? CYS A 385 . ? 1_555 ? 2 AC1 4 CYS A 16 ? CYS A 388 . ? 1_555 ? 3 AC1 4 HIS A 29 ? HIS A 401 . ? 1_555 ? 4 AC1 4 HIS A 33 ? HIS A 405 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 375 ? ? -60.18 -70.14 2 1 LYS A 381 ? ? 59.63 73.69 3 1 CYS A 385 ? ? -113.66 74.29 4 1 LEU A 390 ? ? -168.06 108.64 5 1 VAL A 409 ? ? -172.16 147.36 6 2 SER A 377 ? ? -103.48 44.44 7 2 TYR A 383 ? ? -111.42 76.27 8 2 LEU A 390 ? ? -168.53 106.06 9 3 LYS A 381 ? ? -154.56 73.74 10 3 CYS A 385 ? ? -113.51 74.75 11 3 LEU A 390 ? ? -167.72 109.81 12 4 CYS A 385 ? ? -113.87 74.70 13 4 LEU A 390 ? ? -168.73 105.70 14 4 SER A 408 ? ? -116.74 72.54 15 5 SER A 377 ? ? -114.50 66.31 16 5 LYS A 381 ? ? -160.70 74.03 17 5 CYS A 385 ? ? -113.48 75.05 18 5 LEU A 390 ? ? -169.03 112.42 19 5 LYS A 411 ? ? -59.69 99.13 20 5 PRO A 414 ? ? -69.76 93.79 21 6 TYR A 383 ? ? -112.46 68.33 22 6 LEU A 390 ? ? -168.98 106.33 23 7 SER A 375 ? ? -131.78 -68.70 24 7 LYS A 381 ? ? 56.79 73.71 25 7 CYS A 385 ? ? -113.54 74.65 26 7 LEU A 390 ? ? -168.61 112.97 27 7 HIS A 405 ? ? -91.24 46.68 28 8 CYS A 385 ? ? -117.44 74.94 29 8 LEU A 390 ? ? -168.01 104.11 30 8 SER A 412 ? ? -103.99 -60.22 31 8 PRO A 414 ? ? -69.79 -175.32 32 9 LYS A 381 ? ? -168.46 73.57 33 9 CYS A 385 ? ? -113.37 75.25 34 9 LEU A 390 ? ? -168.43 110.88 35 10 LEU A 390 ? ? -165.81 108.40 36 11 SER A 378 ? ? -100.40 68.29 37 11 TYR A 383 ? ? -101.59 77.02 38 11 CYS A 385 ? ? -113.36 75.87 39 11 LEU A 390 ? ? -167.57 106.69 40 11 SER A 415 ? ? -102.11 62.36 41 12 CYS A 385 ? ? -114.75 74.23 42 12 LEU A 390 ? ? -166.68 110.30 43 13 SER A 378 ? ? -97.66 -65.29 44 13 CYS A 385 ? ? -113.66 74.16 45 13 LEU A 390 ? ? -167.23 104.71 46 14 CYS A 385 ? ? -115.17 74.25 47 14 LEU A 390 ? ? -166.83 113.36 48 14 PRO A 414 ? ? -69.75 91.82 49 15 CYS A 385 ? ? -113.63 74.37 50 15 LEU A 390 ? ? -166.58 109.51 51 15 SER A 408 ? ? -118.74 64.99 52 16 SER A 374 ? ? -110.83 66.65 53 16 CYS A 385 ? ? -115.38 74.23 54 17 CYS A 385 ? ? -117.25 74.25 55 17 LEU A 390 ? ? -166.88 113.54 56 17 SER A 408 ? ? -52.40 109.06 57 17 LYS A 411 ? ? -104.08 -65.03 58 18 GLU A 380 ? ? -170.95 137.25 59 18 CYS A 385 ? ? -116.13 74.32 60 19 SER A 374 ? ? -95.29 -65.56 61 19 SER A 377 ? ? -171.34 137.75 62 19 LYS A 381 ? ? 63.10 160.60 63 19 CYS A 385 ? ? -114.36 74.21 64 19 SER A 412 ? ? -113.65 77.05 65 20 CYS A 385 ? ? -115.62 74.31 66 20 LEU A 390 ? ? -168.06 115.61 67 20 VAL A 409 ? ? 58.54 70.17 68 20 SER A 415 ? ? -103.29 68.74 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2EPQ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EPQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.97mM 13C-15N PROTEIN; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM ZnCl2, 1mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2EPQ _pdbx_nmr_refine.method 'torsion angle dyanamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20060702 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASP N N N N 28 ASP CA C N S 29 ASP C C N N 30 ASP O O N N 31 ASP CB C N N 32 ASP CG C N N 33 ASP OD1 O N N 34 ASP OD2 O N N 35 ASP OXT O N N 36 ASP H H N N 37 ASP H2 H N N 38 ASP HA H N N 39 ASP HB2 H N N 40 ASP HB3 H N N 41 ASP HD2 H N N 42 ASP HXT H N N 43 CYS N N N N 44 CYS CA C N R 45 CYS C C N N 46 CYS O O N N 47 CYS CB C N N 48 CYS SG S N N 49 CYS OXT O N N 50 CYS H H N N 51 CYS H2 H N N 52 CYS HA H N N 53 CYS HB2 H N N 54 CYS HB3 H N N 55 CYS HG H N N 56 CYS HXT H N N 57 GLU N N N N 58 GLU CA C N S 59 GLU C C N N 60 GLU O O N N 61 GLU CB C N N 62 GLU CG C N N 63 GLU CD C N N 64 GLU OE1 O N N 65 GLU OE2 O N N 66 GLU OXT O N N 67 GLU H H N N 68 GLU H2 H N N 69 GLU HA H N N 70 GLU HB2 H N N 71 GLU HB3 H N N 72 GLU HG2 H N N 73 GLU HG3 H N N 74 GLU HE2 H N N 75 GLU HXT H N N 76 GLY N N N N 77 GLY CA C N N 78 GLY C C N N 79 GLY O O N N 80 GLY OXT O N N 81 GLY H H N N 82 GLY H2 H N N 83 GLY HA2 H N N 84 GLY HA3 H N N 85 GLY HXT H N N 86 HIS N N N N 87 HIS CA C N S 88 HIS C C N N 89 HIS O O N N 90 HIS CB C N N 91 HIS CG C Y N 92 HIS ND1 N Y N 93 HIS CD2 C Y N 94 HIS CE1 C Y N 95 HIS NE2 N Y N 96 HIS OXT O N N 97 HIS H H N N 98 HIS H2 H N N 99 HIS HA H N N 100 HIS HB2 H N N 101 HIS HB3 H N N 102 HIS HD1 H N N 103 HIS HD2 H N N 104 HIS HE1 H N N 105 HIS HE2 H N N 106 HIS HXT H N N 107 LEU N N N N 108 LEU CA C N S 109 LEU C C N N 110 LEU O O N N 111 LEU CB C N N 112 LEU CG C N N 113 LEU CD1 C N N 114 LEU CD2 C N N 115 LEU OXT O N N 116 LEU H H N N 117 LEU H2 H N N 118 LEU HA H N N 119 LEU HB2 H N N 120 LEU HB3 H N N 121 LEU HG H N N 122 LEU HD11 H N N 123 LEU HD12 H N N 124 LEU HD13 H N N 125 LEU HD21 H N N 126 LEU HD22 H N N 127 LEU HD23 H N N 128 LEU HXT H N N 129 LYS N N N N 130 LYS CA C N S 131 LYS C C N N 132 LYS O O N N 133 LYS CB C N N 134 LYS CG C N N 135 LYS CD C N N 136 LYS CE C N N 137 LYS NZ N N N 138 LYS OXT O N N 139 LYS H H N N 140 LYS H2 H N N 141 LYS HA H N N 142 LYS HB2 H N N 143 LYS HB3 H N N 144 LYS HG2 H N N 145 LYS HG3 H N N 146 LYS HD2 H N N 147 LYS HD3 H N N 148 LYS HE2 H N N 149 LYS HE3 H N N 150 LYS HZ1 H N N 151 LYS HZ2 H N N 152 LYS HZ3 H N N 153 LYS HXT H N N 154 MET N N N N 155 MET CA C N S 156 MET C C N N 157 MET O O N N 158 MET CB C N N 159 MET CG C N N 160 MET SD S N N 161 MET CE C N N 162 MET OXT O N N 163 MET H H N N 164 MET H2 H N N 165 MET HA H N N 166 MET HB2 H N N 167 MET HB3 H N N 168 MET HG2 H N N 169 MET HG3 H N N 170 MET HE1 H N N 171 MET HE2 H N N 172 MET HE3 H N N 173 MET HXT H N N 174 PHE N N N N 175 PHE CA C N S 176 PHE C C N N 177 PHE O O N N 178 PHE CB C N N 179 PHE CG C Y N 180 PHE CD1 C Y N 181 PHE CD2 C Y N 182 PHE CE1 C Y N 183 PHE CE2 C Y N 184 PHE CZ C Y N 185 PHE OXT O N N 186 PHE H H N N 187 PHE H2 H N N 188 PHE HA H N N 189 PHE HB2 H N N 190 PHE HB3 H N N 191 PHE HD1 H N N 192 PHE HD2 H N N 193 PHE HE1 H N N 194 PHE HE2 H N N 195 PHE HZ H N N 196 PHE HXT H N N 197 PRO N N N N 198 PRO CA C N S 199 PRO C C N N 200 PRO O O N N 201 PRO CB C N N 202 PRO CG C N N 203 PRO CD C N N 204 PRO OXT O N N 205 PRO H H N N 206 PRO HA H N N 207 PRO HB2 H N N 208 PRO HB3 H N N 209 PRO HG2 H N N 210 PRO HG3 H N N 211 PRO HD2 H N N 212 PRO HD3 H N N 213 PRO HXT H N N 214 SER N N N N 215 SER CA C N S 216 SER C C N N 217 SER O O N N 218 SER CB C N N 219 SER OG O N N 220 SER OXT O N N 221 SER H H N N 222 SER H2 H N N 223 SER HA H N N 224 SER HB2 H N N 225 SER HB3 H N N 226 SER HG H N N 227 SER HXT H N N 228 TYR N N N N 229 TYR CA C N S 230 TYR C C N N 231 TYR O O N N 232 TYR CB C N N 233 TYR CG C Y N 234 TYR CD1 C Y N 235 TYR CD2 C Y N 236 TYR CE1 C Y N 237 TYR CE2 C Y N 238 TYR CZ C Y N 239 TYR OH O N N 240 TYR OXT O N N 241 TYR H H N N 242 TYR H2 H N N 243 TYR HA H N N 244 TYR HB2 H N N 245 TYR HB3 H N N 246 TYR HD1 H N N 247 TYR HD2 H N N 248 TYR HE1 H N N 249 TYR HE2 H N N 250 TYR HH H N N 251 TYR HXT H N N 252 VAL N N N N 253 VAL CA C N S 254 VAL C C N N 255 VAL O O N N 256 VAL CB C N N 257 VAL CG1 C N N 258 VAL CG2 C N N 259 VAL OXT O N N 260 VAL H H N N 261 VAL H2 H N N 262 VAL HA H N N 263 VAL HB H N N 264 VAL HG11 H N N 265 VAL HG12 H N N 266 VAL HG13 H N N 267 VAL HG21 H N N 268 VAL HG22 H N N 269 VAL HG23 H N N 270 VAL HXT H N N 271 ZN ZN ZN N N 272 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASP N CA sing N N 27 ASP N H sing N N 28 ASP N H2 sing N N 29 ASP CA C sing N N 30 ASP CA CB sing N N 31 ASP CA HA sing N N 32 ASP C O doub N N 33 ASP C OXT sing N N 34 ASP CB CG sing N N 35 ASP CB HB2 sing N N 36 ASP CB HB3 sing N N 37 ASP CG OD1 doub N N 38 ASP CG OD2 sing N N 39 ASP OD2 HD2 sing N N 40 ASP OXT HXT sing N N 41 CYS N CA sing N N 42 CYS N H sing N N 43 CYS N H2 sing N N 44 CYS CA C sing N N 45 CYS CA CB sing N N 46 CYS CA HA sing N N 47 CYS C O doub N N 48 CYS C OXT sing N N 49 CYS CB SG sing N N 50 CYS CB HB2 sing N N 51 CYS CB HB3 sing N N 52 CYS SG HG sing N N 53 CYS OXT HXT sing N N 54 GLU N CA sing N N 55 GLU N H sing N N 56 GLU N H2 sing N N 57 GLU CA C sing N N 58 GLU CA CB sing N N 59 GLU CA HA sing N N 60 GLU C O doub N N 61 GLU C OXT sing N N 62 GLU CB CG sing N N 63 GLU CB HB2 sing N N 64 GLU CB HB3 sing N N 65 GLU CG CD sing N N 66 GLU CG HG2 sing N N 67 GLU CG HG3 sing N N 68 GLU CD OE1 doub N N 69 GLU CD OE2 sing N N 70 GLU OE2 HE2 sing N N 71 GLU OXT HXT sing N N 72 GLY N CA sing N N 73 GLY N H sing N N 74 GLY N H2 sing N N 75 GLY CA C sing N N 76 GLY CA HA2 sing N N 77 GLY CA HA3 sing N N 78 GLY C O doub N N 79 GLY C OXT sing N N 80 GLY OXT HXT sing N N 81 HIS N CA sing N N 82 HIS N H sing N N 83 HIS N H2 sing N N 84 HIS CA C sing N N 85 HIS CA CB sing N N 86 HIS CA HA sing N N 87 HIS C O doub N N 88 HIS C OXT sing N N 89 HIS CB CG sing N N 90 HIS CB HB2 sing N N 91 HIS CB HB3 sing N N 92 HIS CG ND1 sing Y N 93 HIS CG CD2 doub Y N 94 HIS ND1 CE1 doub Y N 95 HIS ND1 HD1 sing N N 96 HIS CD2 NE2 sing Y N 97 HIS CD2 HD2 sing N N 98 HIS CE1 NE2 sing Y N 99 HIS CE1 HE1 sing N N 100 HIS NE2 HE2 sing N N 101 HIS OXT HXT sing N N 102 LEU N CA sing N N 103 LEU N H sing N N 104 LEU N H2 sing N N 105 LEU CA C sing N N 106 LEU CA CB sing N N 107 LEU CA HA sing N N 108 LEU C O doub N N 109 LEU C OXT sing N N 110 LEU CB CG sing N N 111 LEU CB HB2 sing N N 112 LEU CB HB3 sing N N 113 LEU CG CD1 sing N N 114 LEU CG CD2 sing N N 115 LEU CG HG sing N N 116 LEU CD1 HD11 sing N N 117 LEU CD1 HD12 sing N N 118 LEU CD1 HD13 sing N N 119 LEU CD2 HD21 sing N N 120 LEU CD2 HD22 sing N N 121 LEU CD2 HD23 sing N N 122 LEU OXT HXT sing N N 123 LYS N CA sing N N 124 LYS N H sing N N 125 LYS N H2 sing N N 126 LYS CA C sing N N 127 LYS CA CB sing N N 128 LYS CA HA sing N N 129 LYS C O doub N N 130 LYS C OXT sing N N 131 LYS CB CG sing N N 132 LYS CB HB2 sing N N 133 LYS CB HB3 sing N N 134 LYS CG CD sing N N 135 LYS CG HG2 sing N N 136 LYS CG HG3 sing N N 137 LYS CD CE sing N N 138 LYS CD HD2 sing N N 139 LYS CD HD3 sing N N 140 LYS CE NZ sing N N 141 LYS CE HE2 sing N N 142 LYS CE HE3 sing N N 143 LYS NZ HZ1 sing N N 144 LYS NZ HZ2 sing N N 145 LYS NZ HZ3 sing N N 146 LYS OXT HXT sing N N 147 MET N CA sing N N 148 MET N H sing N N 149 MET N H2 sing N N 150 MET CA C sing N N 151 MET CA CB sing N N 152 MET CA HA sing N N 153 MET C O doub N N 154 MET C OXT sing N N 155 MET CB CG sing N N 156 MET CB HB2 sing N N 157 MET CB HB3 sing N N 158 MET CG SD sing N N 159 MET CG HG2 sing N N 160 MET CG HG3 sing N N 161 MET SD CE sing N N 162 MET CE HE1 sing N N 163 MET CE HE2 sing N N 164 MET CE HE3 sing N N 165 MET OXT HXT sing N N 166 PHE N CA sing N N 167 PHE N H sing N N 168 PHE N H2 sing N N 169 PHE CA C sing N N 170 PHE CA CB sing N N 171 PHE CA HA sing N N 172 PHE C O doub N N 173 PHE C OXT sing N N 174 PHE CB CG sing N N 175 PHE CB HB2 sing N N 176 PHE CB HB3 sing N N 177 PHE CG CD1 doub Y N 178 PHE CG CD2 sing Y N 179 PHE CD1 CE1 sing Y N 180 PHE CD1 HD1 sing N N 181 PHE CD2 CE2 doub Y N 182 PHE CD2 HD2 sing N N 183 PHE CE1 CZ doub Y N 184 PHE CE1 HE1 sing N N 185 PHE CE2 CZ sing Y N 186 PHE CE2 HE2 sing N N 187 PHE CZ HZ sing N N 188 PHE OXT HXT sing N N 189 PRO N CA sing N N 190 PRO N CD sing N N 191 PRO N H sing N N 192 PRO CA C sing N N 193 PRO CA CB sing N N 194 PRO CA HA sing N N 195 PRO C O doub N N 196 PRO C OXT sing N N 197 PRO CB CG sing N N 198 PRO CB HB2 sing N N 199 PRO CB HB3 sing N N 200 PRO CG CD sing N N 201 PRO CG HG2 sing N N 202 PRO CG HG3 sing N N 203 PRO CD HD2 sing N N 204 PRO CD HD3 sing N N 205 PRO OXT HXT sing N N 206 SER N CA sing N N 207 SER N H sing N N 208 SER N H2 sing N N 209 SER CA C sing N N 210 SER CA CB sing N N 211 SER CA HA sing N N 212 SER C O doub N N 213 SER C OXT sing N N 214 SER CB OG sing N N 215 SER CB HB2 sing N N 216 SER CB HB3 sing N N 217 SER OG HG sing N N 218 SER OXT HXT sing N N 219 TYR N CA sing N N 220 TYR N H sing N N 221 TYR N H2 sing N N 222 TYR CA C sing N N 223 TYR CA CB sing N N 224 TYR CA HA sing N N 225 TYR C O doub N N 226 TYR C OXT sing N N 227 TYR CB CG sing N N 228 TYR CB HB2 sing N N 229 TYR CB HB3 sing N N 230 TYR CG CD1 doub Y N 231 TYR CG CD2 sing Y N 232 TYR CD1 CE1 sing Y N 233 TYR CD1 HD1 sing N N 234 TYR CD2 CE2 doub Y N 235 TYR CD2 HD2 sing N N 236 TYR CE1 CZ doub Y N 237 TYR CE1 HE1 sing N N 238 TYR CE2 CZ sing Y N 239 TYR CE2 HE2 sing N N 240 TYR CZ OH sing N N 241 TYR OH HH sing N N 242 TYR OXT HXT sing N N 243 VAL N CA sing N N 244 VAL N H sing N N 245 VAL N H2 sing N N 246 VAL CA C sing N N 247 VAL CA CB sing N N 248 VAL CA HA sing N N 249 VAL C O doub N N 250 VAL C OXT sing N N 251 VAL CB CG1 sing N N 252 VAL CB CG2 sing N N 253 VAL CB HB sing N N 254 VAL CG1 HG11 sing N N 255 VAL CG1 HG12 sing N N 256 VAL CG1 HG13 sing N N 257 VAL CG2 HG21 sing N N 258 VAL CG2 HG22 sing N N 259 VAL CG2 HG23 sing N N 260 VAL OXT HXT sing N N 261 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EPQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_