data_2EXN # _entry.id 2EXN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EXN pdb_00002exn 10.2210/pdb2exn/pdb RCSB RCSB035219 ? ? WWPDB D_1000035219 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-15 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-24 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' citation_author 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_nmr_software 9 5 'Structure model' pdbx_nmr_spectrometer 10 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.name' 2 4 'Structure model' '_citation_author.name' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_pdbx_nmr_software.name' 6 5 'Structure model' '_pdbx_nmr_spectrometer.model' 7 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.pdb_id 2EXN _pdbx_database_PDB_obs_spr.replace_pdb_id 2B2M _pdbx_database_PDB_obs_spr.date 2005-11-15 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EXN _pdbx_database_status.recvd_initial_deposition_date 2005-11-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 6693 'Complete NMR resonance assignment. Contains raw data files' unspecified TargetDB BeR44 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rossi, P.' 1 'Ramelot, T.' 2 'Xiao, R.' 3 'Ho, C.K.' 4 'Ma, L.-C.' 5 'Acton, T.B.' 6 'Kennedy, M.A.' 7 'Montelione, G.T.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 # _citation.id primary _citation.title '(1)H, (13)C, and (15)N Resonance Assignments for the Protein Coded by Gene Locus BB0938 of Bordetella bronchiseptica' _citation.journal_abbrev J.Biomol.NMR _citation.journal_volume 33 _citation.page_first 197 _citation.page_last 197 _citation.year 2005 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16331425 _citation.pdbx_database_id_DOI 10.1007/s10858-005-2593-3 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rossi, P.' 1 ? primary 'Ramelot, T.' 2 ? primary 'Xiao, R.' 3 ? primary 'Ho, C.K.' 4 ? primary 'Ma, L.-C.' 5 ? primary 'Acton, T.B.' 6 ? primary 'Kennedy, M.A.' 7 ? primary 'Montelione, G.T.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein BoR11' _entity.formula_weight 15296.335 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSTTAYQPIAECGATTQSEAAAYQKRWLVANDAGQWLNRDLCPRLAEVSVELRMGYLVLKAPGMLRLDIPLDVIEDDDSV RYQMLVGEQTVDVVDEGELAAAWISNHAGVPCRILKVHPDMAEVRWPSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSTTAYQPIAECGATTQSEAAAYQKRWLVANDAGQWLNRDLCPRLAEVSVELRMGYLVLKAPGMLRLDIPLDVIEDDDSV RYQMLVGEQTVDVVDEGELAAAWISNHAGVPCRILKVHPDMAEVRWPSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BeR44 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 THR n 1 4 THR n 1 5 ALA n 1 6 TYR n 1 7 GLN n 1 8 PRO n 1 9 ILE n 1 10 ALA n 1 11 GLU n 1 12 CYS n 1 13 GLY n 1 14 ALA n 1 15 THR n 1 16 THR n 1 17 GLN n 1 18 SER n 1 19 GLU n 1 20 ALA n 1 21 ALA n 1 22 ALA n 1 23 TYR n 1 24 GLN n 1 25 LYS n 1 26 ARG n 1 27 TRP n 1 28 LEU n 1 29 VAL n 1 30 ALA n 1 31 ASN n 1 32 ASP n 1 33 ALA n 1 34 GLY n 1 35 GLN n 1 36 TRP n 1 37 LEU n 1 38 ASN n 1 39 ARG n 1 40 ASP n 1 41 LEU n 1 42 CYS n 1 43 PRO n 1 44 ARG n 1 45 LEU n 1 46 ALA n 1 47 GLU n 1 48 VAL n 1 49 SER n 1 50 VAL n 1 51 GLU n 1 52 LEU n 1 53 ARG n 1 54 MET n 1 55 GLY n 1 56 TYR n 1 57 LEU n 1 58 VAL n 1 59 LEU n 1 60 LYS n 1 61 ALA n 1 62 PRO n 1 63 GLY n 1 64 MET n 1 65 LEU n 1 66 ARG n 1 67 LEU n 1 68 ASP n 1 69 ILE n 1 70 PRO n 1 71 LEU n 1 72 ASP n 1 73 VAL n 1 74 ILE n 1 75 GLU n 1 76 ASP n 1 77 ASP n 1 78 ASP n 1 79 SER n 1 80 VAL n 1 81 ARG n 1 82 TYR n 1 83 GLN n 1 84 MET n 1 85 LEU n 1 86 VAL n 1 87 GLY n 1 88 GLU n 1 89 GLN n 1 90 THR n 1 91 VAL n 1 92 ASP n 1 93 VAL n 1 94 VAL n 1 95 ASP n 1 96 GLU n 1 97 GLY n 1 98 GLU n 1 99 LEU n 1 100 ALA n 1 101 ALA n 1 102 ALA n 1 103 TRP n 1 104 ILE n 1 105 SER n 1 106 ASN n 1 107 HIS n 1 108 ALA n 1 109 GLY n 1 110 VAL n 1 111 PRO n 1 112 CYS n 1 113 ARG n 1 114 ILE n 1 115 LEU n 1 116 LYS n 1 117 VAL n 1 118 HIS n 1 119 PRO n 1 120 ASP n 1 121 MET n 1 122 ALA n 1 123 GLU n 1 124 VAL n 1 125 ARG n 1 126 TRP n 1 127 PRO n 1 128 SER n 1 129 LEU n 1 130 GLU n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bordetella _entity_src_gen.pdbx_gene_src_gene BB0938 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bordetella bronchiseptica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 518 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET21d _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pBoR11-21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 TRP 103 103 103 TRP TRP A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 CYS 112 112 112 CYS CYS A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 HIS 131 131 ? ? ? A . n A 1 132 HIS 132 132 ? ? ? A . n A 1 133 HIS 133 133 ? ? ? A . n A 1 134 HIS 134 134 ? ? ? A . n A 1 135 HIS 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n # _exptl.entry_id 2EXN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EXN _struct.title ;Solution structure for the protein coded by gene locus BB0938 of Bordetella bronchiseptica. Northeast Structural Genomics target BoR11. ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EXN _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Beta barrel containing fold; AutoStructure; AutoAssign; NMR structure; BoR11, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7WNU7_BORBR _struct_ref.pdbx_db_accession Q7WNU7 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSTTAYQPIAECGATTQSEAAAYQKRWLVANDAGQWLNRDLCPRLAEVSVELRMGYLVLKAPGMLRLDIPLDVIEDDDSV RYQMLVGEQTVDVVDEGELAAAWISNHAGVPCRILKVHPD ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EXN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7WNU7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 120 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EXN MET A 121 ? UNP Q7WNU7 ? ? 'expression tag' 121 1 1 2EXN ALA A 122 ? UNP Q7WNU7 ? ? 'expression tag' 122 2 1 2EXN GLU A 123 ? UNP Q7WNU7 ? ? 'expression tag' 123 3 1 2EXN VAL A 124 ? UNP Q7WNU7 ? ? 'expression tag' 124 4 1 2EXN ARG A 125 ? UNP Q7WNU7 ? ? 'expression tag' 125 5 1 2EXN TRP A 126 ? UNP Q7WNU7 ? ? 'expression tag' 126 6 1 2EXN PRO A 127 ? UNP Q7WNU7 ? ? 'expression tag' 127 7 1 2EXN SER A 128 ? UNP Q7WNU7 ? ? 'expression tag' 128 8 1 2EXN LEU A 129 ? UNP Q7WNU7 ? ? 'expression tag' 129 9 1 2EXN GLU A 130 ? UNP Q7WNU7 ? ? 'expression tag' 130 10 1 2EXN HIS A 131 ? UNP Q7WNU7 ? ? 'expression tag' 131 11 1 2EXN HIS A 132 ? UNP Q7WNU7 ? ? 'expression tag' 132 12 1 2EXN HIS A 133 ? UNP Q7WNU7 ? ? 'expression tag' 133 13 1 2EXN HIS A 134 ? UNP Q7WNU7 ? ? 'expression tag' 134 14 1 2EXN HIS A 135 ? UNP Q7WNU7 ? ? 'expression tag' 135 15 1 2EXN HIS A 136 ? UNP Q7WNU7 ? ? 'expression tag' 136 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 17 ? TYR A 23 ? GLN A 17 TYR A 23 5 ? 7 HELX_P HELX_P2 2 CYS A 42 ? GLU A 47 ? CYS A 42 GLU A 47 5 ? 6 HELX_P HELX_P3 3 GLY A 97 ? ALA A 108 ? GLY A 97 ALA A 108 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 6 ? ILE A 9 ? TYR A 6 ILE A 9 A 2 GLY A 13 ? THR A 15 ? GLY A 13 THR A 15 B 1 TRP A 36 ? LEU A 37 ? TRP A 36 LEU A 37 B 2 TRP A 27 ? ASN A 31 ? TRP A 27 ASN A 31 B 3 CYS A 112 ? VAL A 117 ? CYS A 112 VAL A 117 B 4 GLN A 89 ? VAL A 94 ? GLN A 89 VAL A 94 B 5 TYR A 82 ? VAL A 86 ? TYR A 82 VAL A 86 C 1 SER A 49 ? LEU A 52 ? SER A 49 LEU A 52 C 2 TYR A 56 ? LYS A 60 ? TYR A 56 LYS A 60 C 3 ARG A 66 ? PRO A 70 ? ARG A 66 PRO A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 6 ? N TYR A 6 O THR A 15 ? O THR A 15 B 1 2 O LEU A 37 ? O LEU A 37 N VAL A 29 ? N VAL A 29 B 2 3 N LEU A 28 ? N LEU A 28 O LEU A 115 ? O LEU A 115 B 3 4 O LYS A 116 ? O LYS A 116 N VAL A 94 ? N VAL A 94 B 4 5 O VAL A 93 ? O VAL A 93 N TYR A 82 ? N TYR A 82 C 1 2 N SER A 49 ? N SER A 49 O LYS A 60 ? O LYS A 60 C 2 3 N LEU A 57 ? N LEU A 57 O ILE A 69 ? O ILE A 69 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD1 A HIS 118 ? ? OD2 A ASP 120 ? ? 1.57 2 2 HD22 A ASN 31 ? ? HB3 A GLN 35 ? ? 1.31 3 2 OE2 A GLU 98 ? ? HH12 A ARG 113 ? ? 1.58 4 2 H A LEU 57 ? ? O A ILE 69 ? ? 1.58 5 3 HH21 A ARG 66 ? ? OD2 A ASP 68 ? ? 1.58 6 5 OE2 A GLU 51 ? ? HZ2 A LYS 60 ? ? 1.58 7 8 HD1 A HIS 118 ? ? OD1 A ASP 120 ? ? 1.58 8 9 O A ASN 38 ? ? H A CYS 42 ? ? 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 10 ? ? -73.88 -70.95 2 1 GLU A 47 ? ? -95.66 46.00 3 1 MET A 54 ? ? -67.50 84.15 4 1 PRO A 62 ? ? -66.98 81.23 5 1 LEU A 65 ? ? -68.67 -158.64 6 1 LEU A 71 ? ? -54.21 -74.22 7 1 ASP A 72 ? ? -150.73 28.84 8 1 GLU A 75 ? ? -144.79 23.82 9 1 ASP A 76 ? ? -109.38 -160.53 10 1 VAL A 80 ? ? -68.35 99.74 11 1 PRO A 111 ? ? -62.64 90.88 12 1 ALA A 122 ? ? 67.42 -77.97 13 1 VAL A 124 ? ? -133.90 -30.14 14 1 ARG A 125 ? ? 78.13 -37.97 15 1 TRP A 126 ? ? 77.73 138.35 16 1 SER A 128 ? ? -79.01 24.12 17 2 SER A 2 ? ? -131.55 -38.21 18 2 LEU A 28 ? ? -177.78 -177.27 19 2 MET A 54 ? ? -68.38 91.85 20 2 PRO A 62 ? ? -46.16 107.08 21 2 LEU A 65 ? ? -67.70 -165.87 22 2 ASP A 72 ? ? 75.29 88.55 23 2 GLU A 75 ? ? -73.53 29.72 24 2 PRO A 111 ? ? -60.26 96.71 25 2 GLU A 123 ? ? 65.79 -140.07 26 2 VAL A 124 ? ? 65.67 100.63 27 2 TRP A 126 ? ? 72.58 151.50 28 2 LEU A 129 ? ? 64.64 79.78 29 3 SER A 2 ? ? 62.57 -158.72 30 3 THR A 16 ? ? -87.41 31.66 31 3 GLU A 47 ? ? -92.68 54.62 32 3 PRO A 62 ? ? -60.95 98.03 33 3 LEU A 65 ? ? -69.71 -154.38 34 3 ILE A 74 ? ? -86.15 -85.48 35 3 GLU A 88 ? ? -143.81 16.08 36 3 PRO A 111 ? ? -55.20 97.91 37 3 GLU A 123 ? ? -140.37 -135.00 38 3 VAL A 124 ? ? 67.34 94.44 39 3 TRP A 126 ? ? 70.61 151.56 40 3 PRO A 127 ? ? -37.02 120.50 41 3 SER A 128 ? ? -96.07 40.35 42 4 THR A 4 ? ? 40.34 -137.61 43 4 ALA A 10 ? ? -72.89 -73.03 44 4 GLU A 47 ? ? -85.69 38.97 45 4 MET A 54 ? ? -59.81 98.13 46 4 PRO A 62 ? ? -57.71 102.74 47 4 LEU A 65 ? ? -69.99 -159.10 48 4 ASP A 76 ? ? -87.07 -89.44 49 4 PRO A 111 ? ? -66.48 90.53 50 4 PRO A 119 ? ? -57.58 -5.36 51 4 ALA A 122 ? ? 60.26 -173.38 52 4 GLU A 123 ? ? 57.65 -141.64 53 4 VAL A 124 ? ? 71.30 113.68 54 4 SER A 128 ? ? -94.02 43.79 55 4 LEU A 129 ? ? -77.39 23.92 56 5 LYS A 25 ? ? -163.86 -169.75 57 5 MET A 54 ? ? -62.98 93.68 58 5 PRO A 62 ? ? -62.89 94.74 59 5 LEU A 65 ? ? -63.34 -166.89 60 5 ASP A 76 ? ? -146.03 -59.94 61 5 ASP A 77 ? ? -109.21 -62.61 62 5 ASP A 78 ? ? -83.05 32.99 63 5 PRO A 111 ? ? -63.18 93.11 64 5 ALA A 122 ? ? 58.94 -174.36 65 5 GLU A 123 ? ? 49.78 84.03 66 5 SER A 128 ? ? -85.70 37.84 67 6 THR A 3 ? ? -155.68 -83.55 68 6 THR A 4 ? ? 147.97 146.29 69 6 MET A 54 ? ? -65.43 88.90 70 6 PRO A 62 ? ? -67.14 98.25 71 6 LEU A 65 ? ? -68.15 -149.93 72 6 LEU A 67 ? ? -151.71 87.72 73 6 ASP A 78 ? ? -160.23 44.34 74 6 ALA A 122 ? ? 54.70 -106.85 75 6 GLU A 123 ? ? 66.72 -59.13 76 6 TRP A 126 ? ? 72.35 152.41 77 6 PRO A 127 ? ? -25.86 -54.39 78 6 SER A 128 ? ? -171.84 82.69 79 7 LYS A 25 ? ? -172.65 -160.63 80 7 LEU A 28 ? ? -170.31 -173.79 81 7 MET A 54 ? ? -49.26 98.74 82 7 LEU A 65 ? ? -68.34 -144.58 83 7 ASP A 77 ? ? -81.36 -85.32 84 7 PRO A 111 ? ? -65.84 88.63 85 7 VAL A 124 ? ? -130.47 -66.86 86 7 ARG A 125 ? ? 68.28 121.55 87 7 LEU A 129 ? ? 62.94 91.86 88 8 THR A 4 ? ? 64.29 92.03 89 8 LEU A 28 ? ? 179.49 -176.90 90 8 GLU A 47 ? ? -87.74 31.24 91 8 MET A 54 ? ? -64.00 89.18 92 8 PRO A 62 ? ? -63.35 97.32 93 8 LEU A 65 ? ? -70.91 -144.59 94 8 PRO A 111 ? ? -56.50 99.79 95 8 MET A 121 ? ? -144.72 -44.24 96 8 ALA A 122 ? ? 68.55 -64.45 97 8 GLU A 123 ? ? -70.47 -76.24 98 8 VAL A 124 ? ? 67.43 -77.33 99 8 ARG A 125 ? ? 81.96 131.89 100 8 SER A 128 ? ? -99.91 51.02 101 9 THR A 3 ? ? -89.01 -76.51 102 9 MET A 54 ? ? -62.03 89.59 103 9 PRO A 62 ? ? -65.43 93.33 104 9 LEU A 65 ? ? -67.07 -163.13 105 9 PRO A 111 ? ? -67.88 87.57 106 9 PRO A 119 ? ? -69.76 35.52 107 9 ALA A 122 ? ? 68.21 -66.99 108 9 ARG A 125 ? ? 60.94 66.05 109 10 MET A 54 ? ? -65.35 97.20 110 10 PRO A 62 ? ? -65.37 85.01 111 10 LEU A 65 ? ? -77.12 -144.34 112 10 ASP A 72 ? ? -140.97 15.29 113 10 GLU A 88 ? ? -152.10 18.76 114 10 PRO A 111 ? ? -58.36 96.50 115 10 PRO A 119 ? ? -62.50 15.02 116 10 ALA A 122 ? ? 69.28 -77.94 117 10 GLU A 123 ? ? -59.06 -72.17 118 10 VAL A 124 ? ? 70.99 -58.29 119 10 ARG A 125 ? ? 79.03 -89.35 120 10 TRP A 126 ? ? 162.79 142.57 121 10 SER A 128 ? ? -102.74 46.38 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 2EXN _pdbx_nmr_ensemble.conformers_calculated_total_number 56 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EXN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.7mM BoR11 (U-13C,15N), 0.02% NaN3, 10mM DTT, 5mM CaCl2, 100mM NaCl, 20mM MES, pH 6.5' '5% D2O, 95% H2O' 2 '0.5mM BoR11 (U-13C,15N), 0.02% NaN3, 10mM DTT, 5mM CaCl2, 100mM NaCl, 20mM MES, pH 6.5' '99.9% D2O' 3 '0.8mM BoR11 (5% 13C,U-15N), 0.02% NaN3, 10mM DTT, 5mM CaCl2, 100mM NaCl, 20mM MES, pH 6.5' '5% D2O, 95% H2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure atmospheric _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 4D_13C-separated_NOESY 2 4 1 HNCA-J 3 5 1 'Hi-Res 13C-HSQC for VL stereospecific' 3 6 1 het-NOE 3 # _pdbx_nmr_details.entry_id 2EXN _pdbx_nmr_details.text ;AutoQF scores after CNS with explicit H2O refinement: final M-score: 0.188 final dp-score: 0.73 (recall=0.986, precision=0.857, F-measure=0.917) ; # _pdbx_nmr_refine.entry_id 2EXN _pdbx_nmr_refine.method ;CS assignment: Backbone AutoAssign, manual sidechain HcCH-COSY and TOCSYs. AutoStructure for noesy assign. Hyper Dihedral, Dyana, Xplor(nih), and CNS force-field for simulated annealing (Dyana,xplor run within AutoStructure GUI) ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1c 'Varian Inc.' 1 collection XwinNMR 3.5 'Bruker Biospin AG' 2 'data analysis' NMRPipe 2.1 Delaglio 3 'structure solution' AutoStructure 2.1.1 'Huang, Montelione' 4 'data analysis' AutoAssign 1.15 'Zimmerman, Moseley, Montelione' 5 'data analysis' Sparky 3.91 Goddard 6 refinement CNS 1.1 Brunger 7 'structure solution' 'xplor(nih)' 2.0.6 'Schwieters, Clore' 8 'structure solution' DYANA 1.5 Guntert 9 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 131 ? A HIS 131 2 1 Y 1 A HIS 132 ? A HIS 132 3 1 Y 1 A HIS 133 ? A HIS 133 4 1 Y 1 A HIS 134 ? A HIS 134 5 1 Y 1 A HIS 135 ? A HIS 135 6 1 Y 1 A HIS 136 ? A HIS 136 7 2 Y 1 A HIS 131 ? A HIS 131 8 2 Y 1 A HIS 132 ? A HIS 132 9 2 Y 1 A HIS 133 ? A HIS 133 10 2 Y 1 A HIS 134 ? A HIS 134 11 2 Y 1 A HIS 135 ? A HIS 135 12 2 Y 1 A HIS 136 ? A HIS 136 13 3 Y 1 A HIS 131 ? A HIS 131 14 3 Y 1 A HIS 132 ? A HIS 132 15 3 Y 1 A HIS 133 ? A HIS 133 16 3 Y 1 A HIS 134 ? A HIS 134 17 3 Y 1 A HIS 135 ? A HIS 135 18 3 Y 1 A HIS 136 ? A HIS 136 19 4 Y 1 A HIS 131 ? A HIS 131 20 4 Y 1 A HIS 132 ? A HIS 132 21 4 Y 1 A HIS 133 ? A HIS 133 22 4 Y 1 A HIS 134 ? A HIS 134 23 4 Y 1 A HIS 135 ? A HIS 135 24 4 Y 1 A HIS 136 ? A HIS 136 25 5 Y 1 A HIS 131 ? A HIS 131 26 5 Y 1 A HIS 132 ? A HIS 132 27 5 Y 1 A HIS 133 ? A HIS 133 28 5 Y 1 A HIS 134 ? A HIS 134 29 5 Y 1 A HIS 135 ? A HIS 135 30 5 Y 1 A HIS 136 ? A HIS 136 31 6 Y 1 A HIS 131 ? A HIS 131 32 6 Y 1 A HIS 132 ? A HIS 132 33 6 Y 1 A HIS 133 ? A HIS 133 34 6 Y 1 A HIS 134 ? A HIS 134 35 6 Y 1 A HIS 135 ? A HIS 135 36 6 Y 1 A HIS 136 ? A HIS 136 37 7 Y 1 A HIS 131 ? A HIS 131 38 7 Y 1 A HIS 132 ? A HIS 132 39 7 Y 1 A HIS 133 ? A HIS 133 40 7 Y 1 A HIS 134 ? A HIS 134 41 7 Y 1 A HIS 135 ? A HIS 135 42 7 Y 1 A HIS 136 ? A HIS 136 43 8 Y 1 A HIS 131 ? A HIS 131 44 8 Y 1 A HIS 132 ? A HIS 132 45 8 Y 1 A HIS 133 ? A HIS 133 46 8 Y 1 A HIS 134 ? A HIS 134 47 8 Y 1 A HIS 135 ? A HIS 135 48 8 Y 1 A HIS 136 ? A HIS 136 49 9 Y 1 A HIS 131 ? A HIS 131 50 9 Y 1 A HIS 132 ? A HIS 132 51 9 Y 1 A HIS 133 ? A HIS 133 52 9 Y 1 A HIS 134 ? A HIS 134 53 9 Y 1 A HIS 135 ? A HIS 135 54 9 Y 1 A HIS 136 ? A HIS 136 55 10 Y 1 A HIS 131 ? A HIS 131 56 10 Y 1 A HIS 132 ? A HIS 132 57 10 Y 1 A HIS 133 ? A HIS 133 58 10 Y 1 A HIS 134 ? A HIS 134 59 10 Y 1 A HIS 135 ? A HIS 135 60 10 Y 1 A HIS 136 ? A HIS 136 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PRO N N N N 247 PRO CA C N S 248 PRO C C N N 249 PRO O O N N 250 PRO CB C N N 251 PRO CG C N N 252 PRO CD C N N 253 PRO OXT O N N 254 PRO H H N N 255 PRO HA H N N 256 PRO HB2 H N N 257 PRO HB3 H N N 258 PRO HG2 H N N 259 PRO HG3 H N N 260 PRO HD2 H N N 261 PRO HD3 H N N 262 PRO HXT H N N 263 SER N N N N 264 SER CA C N S 265 SER C C N N 266 SER O O N N 267 SER CB C N N 268 SER OG O N N 269 SER OXT O N N 270 SER H H N N 271 SER H2 H N N 272 SER HA H N N 273 SER HB2 H N N 274 SER HB3 H N N 275 SER HG H N N 276 SER HXT H N N 277 THR N N N N 278 THR CA C N S 279 THR C C N N 280 THR O O N N 281 THR CB C N R 282 THR OG1 O N N 283 THR CG2 C N N 284 THR OXT O N N 285 THR H H N N 286 THR H2 H N N 287 THR HA H N N 288 THR HB H N N 289 THR HG1 H N N 290 THR HG21 H N N 291 THR HG22 H N N 292 THR HG23 H N N 293 THR HXT H N N 294 TRP N N N N 295 TRP CA C N S 296 TRP C C N N 297 TRP O O N N 298 TRP CB C N N 299 TRP CG C Y N 300 TRP CD1 C Y N 301 TRP CD2 C Y N 302 TRP NE1 N Y N 303 TRP CE2 C Y N 304 TRP CE3 C Y N 305 TRP CZ2 C Y N 306 TRP CZ3 C Y N 307 TRP CH2 C Y N 308 TRP OXT O N N 309 TRP H H N N 310 TRP H2 H N N 311 TRP HA H N N 312 TRP HB2 H N N 313 TRP HB3 H N N 314 TRP HD1 H N N 315 TRP HE1 H N N 316 TRP HE3 H N N 317 TRP HZ2 H N N 318 TRP HZ3 H N N 319 TRP HH2 H N N 320 TRP HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PRO N CA sing N N 235 PRO N CD sing N N 236 PRO N H sing N N 237 PRO CA C sing N N 238 PRO CA CB sing N N 239 PRO CA HA sing N N 240 PRO C O doub N N 241 PRO C OXT sing N N 242 PRO CB CG sing N N 243 PRO CB HB2 sing N N 244 PRO CB HB3 sing N N 245 PRO CG CD sing N N 246 PRO CG HG2 sing N N 247 PRO CG HG3 sing N N 248 PRO CD HD2 sing N N 249 PRO CD HD3 sing N N 250 PRO OXT HXT sing N N 251 SER N CA sing N N 252 SER N H sing N N 253 SER N H2 sing N N 254 SER CA C sing N N 255 SER CA CB sing N N 256 SER CA HA sing N N 257 SER C O doub N N 258 SER C OXT sing N N 259 SER CB OG sing N N 260 SER CB HB2 sing N N 261 SER CB HB3 sing N N 262 SER OG HG sing N N 263 SER OXT HXT sing N N 264 THR N CA sing N N 265 THR N H sing N N 266 THR N H2 sing N N 267 THR CA C sing N N 268 THR CA CB sing N N 269 THR CA HA sing N N 270 THR C O doub N N 271 THR C OXT sing N N 272 THR CB OG1 sing N N 273 THR CB CG2 sing N N 274 THR CB HB sing N N 275 THR OG1 HG1 sing N N 276 THR CG2 HG21 sing N N 277 THR CG2 HG22 sing N N 278 THR CG2 HG23 sing N N 279 THR OXT HXT sing N N 280 TRP N CA sing N N 281 TRP N H sing N N 282 TRP N H2 sing N N 283 TRP CA C sing N N 284 TRP CA CB sing N N 285 TRP CA HA sing N N 286 TRP C O doub N N 287 TRP C OXT sing N N 288 TRP CB CG sing N N 289 TRP CB HB2 sing N N 290 TRP CB HB3 sing N N 291 TRP CG CD1 doub Y N 292 TRP CG CD2 sing Y N 293 TRP CD1 NE1 sing Y N 294 TRP CD1 HD1 sing N N 295 TRP CD2 CE2 doub Y N 296 TRP CD2 CE3 sing Y N 297 TRP NE1 CE2 sing Y N 298 TRP NE1 HE1 sing N N 299 TRP CE2 CZ2 sing Y N 300 TRP CE3 CZ3 doub Y N 301 TRP CE3 HE3 sing N N 302 TRP CZ2 CH2 doub Y N 303 TRP CZ2 HZ2 sing N N 304 TRP CZ3 CH2 sing Y N 305 TRP CZ3 HZ3 sing N N 306 TRP CH2 HH2 sing N N 307 TRP OXT HXT sing N N 308 TYR N CA sing N N 309 TYR N H sing N N 310 TYR N H2 sing N N 311 TYR CA C sing N N 312 TYR CA CB sing N N 313 TYR CA HA sing N N 314 TYR C O doub N N 315 TYR C OXT sing N N 316 TYR CB CG sing N N 317 TYR CB HB2 sing N N 318 TYR CB HB3 sing N N 319 TYR CG CD1 doub Y N 320 TYR CG CD2 sing Y N 321 TYR CD1 CE1 sing Y N 322 TYR CD1 HD1 sing N N 323 TYR CD2 CE2 doub Y N 324 TYR CD2 HD2 sing N N 325 TYR CE1 CZ doub Y N 326 TYR CE1 HE1 sing N N 327 TYR CE2 CZ sing Y N 328 TYR CE2 HE2 sing N N 329 TYR CZ OH sing N N 330 TYR OH HH sing N N 331 TYR OXT HXT sing N N 332 VAL N CA sing N N 333 VAL N H sing N N 334 VAL N H2 sing N N 335 VAL CA C sing N N 336 VAL CA CB sing N N 337 VAL CA HA sing N N 338 VAL C O doub N N 339 VAL C OXT sing N N 340 VAL CB CG1 sing N N 341 VAL CB CG2 sing N N 342 VAL CB HB sing N N 343 VAL CG1 HG11 sing N N 344 VAL CG1 HG12 sing N N 345 VAL CG1 HG13 sing N N 346 VAL CG2 HG21 sing N N 347 VAL CG2 HG22 sing N N 348 VAL CG2 HG23 sing N N 349 VAL OXT HXT sing N N 350 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 600 ? 2 INOVA Varian 750 ? 3 INOVA Varian 800 ? 4 AVANCE Bruker 500 ? # _atom_sites.entry_id 2EXN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_