data_2EYZ # _entry.id 2EYZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EYZ pdb_00002eyz 10.2210/pdb2eyz/pdb RCSB RCSB035266 ? ? WWPDB D_1000035266 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2EYV . unspecified PDB 2EYW . unspecified PDB 2EYX . unspecified PDB 2EYY . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EYZ _pdbx_database_status.recvd_initial_deposition_date 2005-11-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kobashigawa, Y.' 1 'Tanaka, S.' 2 'Inagaki, F.' 3 # _citation.id primary _citation.title 'Structural basis for the transforming activity of human cancer-related signaling adaptor protein CRK.' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 14 _citation.page_first 503 _citation.page_last 510 _citation.year 2007 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17515907 _citation.pdbx_database_id_DOI 10.1038/nsmb1241 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kobashigawa, Y.' 1 ? primary 'Sakai, M.' 2 ? primary 'Naito, M.' 3 ? primary 'Yokochi, M.' 4 ? primary 'Kumeta, H.' 5 ? primary 'Makino, Y.' 6 ? primary 'Ogura, K.' 7 ? primary 'Tanaka, S.' 8 ? primary 'Inagaki, F.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'v-crk sarcoma virus CT10 oncogene homolog isoform a' _entity.formula_weight 33882.605 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CT10-Regulated Kinase isoform II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPEEDFS ; _entity_poly.pdbx_seq_one_letter_code_can ;MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPEEDFS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLY n 1 4 ASN n 1 5 PHE n 1 6 ASP n 1 7 SER n 1 8 GLU n 1 9 GLU n 1 10 ARG n 1 11 SER n 1 12 SER n 1 13 TRP n 1 14 TYR n 1 15 TRP n 1 16 GLY n 1 17 ARG n 1 18 LEU n 1 19 SER n 1 20 ARG n 1 21 GLN n 1 22 GLU n 1 23 ALA n 1 24 VAL n 1 25 ALA n 1 26 LEU n 1 27 LEU n 1 28 GLN n 1 29 GLY n 1 30 GLN n 1 31 ARG n 1 32 HIS n 1 33 GLY n 1 34 VAL n 1 35 PHE n 1 36 LEU n 1 37 VAL n 1 38 ARG n 1 39 ASP n 1 40 SER n 1 41 SER n 1 42 THR n 1 43 SER n 1 44 PRO n 1 45 GLY n 1 46 ASP n 1 47 TYR n 1 48 VAL n 1 49 LEU n 1 50 SER n 1 51 VAL n 1 52 SER n 1 53 GLU n 1 54 ASN n 1 55 SER n 1 56 ARG n 1 57 VAL n 1 58 SER n 1 59 HIS n 1 60 TYR n 1 61 ILE n 1 62 ILE n 1 63 ASN n 1 64 SER n 1 65 SER n 1 66 GLY n 1 67 PRO n 1 68 ARG n 1 69 PRO n 1 70 PRO n 1 71 VAL n 1 72 PRO n 1 73 PRO n 1 74 SER n 1 75 PRO n 1 76 ALA n 1 77 GLN n 1 78 PRO n 1 79 PRO n 1 80 PRO n 1 81 GLY n 1 82 VAL n 1 83 SER n 1 84 PRO n 1 85 SER n 1 86 ARG n 1 87 LEU n 1 88 ARG n 1 89 ILE n 1 90 GLY n 1 91 ASP n 1 92 GLN n 1 93 GLU n 1 94 PHE n 1 95 ASP n 1 96 SER n 1 97 LEU n 1 98 PRO n 1 99 ALA n 1 100 LEU n 1 101 LEU n 1 102 GLU n 1 103 PHE n 1 104 TYR n 1 105 LYS n 1 106 ILE n 1 107 HIS n 1 108 TYR n 1 109 LEU n 1 110 ASP n 1 111 THR n 1 112 THR n 1 113 THR n 1 114 LEU n 1 115 ILE n 1 116 GLU n 1 117 PRO n 1 118 VAL n 1 119 SER n 1 120 ARG n 1 121 SER n 1 122 ARG n 1 123 GLN n 1 124 GLY n 1 125 SER n 1 126 GLY n 1 127 VAL n 1 128 ILE n 1 129 LEU n 1 130 ARG n 1 131 GLN n 1 132 GLU n 1 133 GLU n 1 134 ALA n 1 135 GLU n 1 136 TYR n 1 137 VAL n 1 138 ARG n 1 139 ALA n 1 140 LEU n 1 141 PHE n 1 142 ASP n 1 143 PHE n 1 144 ASN n 1 145 GLY n 1 146 ASN n 1 147 ASP n 1 148 GLU n 1 149 GLU n 1 150 ASP n 1 151 LEU n 1 152 PRO n 1 153 PHE n 1 154 LYS n 1 155 LYS n 1 156 GLY n 1 157 ASP n 1 158 ILE n 1 159 LEU n 1 160 ARG n 1 161 ILE n 1 162 ARG n 1 163 ASP n 1 164 LYS n 1 165 PRO n 1 166 GLU n 1 167 GLU n 1 168 GLN n 1 169 TRP n 1 170 TRP n 1 171 ASN n 1 172 ALA n 1 173 GLU n 1 174 ASP n 1 175 SER n 1 176 GLU n 1 177 GLY n 1 178 LYS n 1 179 ARG n 1 180 GLY n 1 181 MET n 1 182 ILE n 1 183 PRO n 1 184 VAL n 1 185 PRO n 1 186 TYR n 1 187 VAL n 1 188 GLU n 1 189 LYS n 1 190 TYR n 1 191 ARG n 1 192 PRO n 1 193 ALA n 1 194 SER n 1 195 ALA n 1 196 SER n 1 197 VAL n 1 198 SER n 1 199 ALA n 1 200 LEU n 1 201 ILE n 1 202 GLY n 1 203 GLY n 1 204 ASN n 1 205 GLN n 1 206 GLU n 1 207 GLY n 1 208 SER n 1 209 HIS n 1 210 PRO n 1 211 GLN n 1 212 PRO n 1 213 LEU n 1 214 GLY n 1 215 GLY n 1 216 PRO n 1 217 GLU n 1 218 PRO n 1 219 GLY n 1 220 PRO n 1 221 TYR n 1 222 ALA n 1 223 GLN n 1 224 PRO n 1 225 SER n 1 226 VAL n 1 227 ASN n 1 228 THR n 1 229 PRO n 1 230 LEU n 1 231 PRO n 1 232 ASN n 1 233 LEU n 1 234 GLN n 1 235 ASN n 1 236 GLY n 1 237 PRO n 1 238 ILE n 1 239 TYR n 1 240 ALA n 1 241 ARG n 1 242 VAL n 1 243 ILE n 1 244 GLN n 1 245 LYS n 1 246 ARG n 1 247 VAL n 1 248 PRO n 1 249 ASN n 1 250 ALA n 1 251 TYR n 1 252 ASP n 1 253 LYS n 1 254 THR n 1 255 ALA n 1 256 LEU n 1 257 ALA n 1 258 LEU n 1 259 GLU n 1 260 VAL n 1 261 GLY n 1 262 GLU n 1 263 LEU n 1 264 VAL n 1 265 LYS n 1 266 VAL n 1 267 THR n 1 268 LYS n 1 269 ILE n 1 270 ASN n 1 271 VAL n 1 272 SER n 1 273 GLY n 1 274 GLN n 1 275 TRP n 1 276 GLU n 1 277 GLY n 1 278 GLU n 1 279 CYS n 1 280 ASN n 1 281 GLY n 1 282 LYS n 1 283 ARG n 1 284 GLY n 1 285 HIS n 1 286 PHE n 1 287 PRO n 1 288 PHE n 1 289 THR n 1 290 HIS n 1 291 VAL n 1 292 ARG n 1 293 LEU n 1 294 LEU n 1 295 ASP n 1 296 GLN n 1 297 GLN n 1 298 ASN n 1 299 PRO n 1 300 GLU n 1 301 GLU n 1 302 ASP n 1 303 PHE n 1 304 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pPRO EX-htb' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q96HJ0_HUMAN _struct_ref.pdbx_db_accession Q96HJ0 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EYZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 304 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96HJ0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 304 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 304 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2EYZ _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 300 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q96HJ0 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 300 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 300 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-SEPARATED_NOESY 1 2 1 '3D_ 13C-SEPARATED_NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 250mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.4mM isoform II U-15N, 13C PHOSPHATE BUFFER NA; 200MM NACL;90%H2O, 10%D2O' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EYZ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EYZ _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EYZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 2.0 'Guetntert P.' 1 refinement CNS 1.1 ? 2 'structure solution' XEASY ? ? 3 'structure solution' Olivia ? ? 4 'structure solution' NMRPipe ? ? 5 'structure solution' CYANA 2.0 'Guetntert P.' 6 # _exptl.entry_id 2EYZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EYZ _struct.title 'CT10-Regulated Kinase isoform II' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EYZ _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'SH2, SH3, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 21 ? LEU A 26 ? GLN A 21 LEU A 26 1 ? 6 HELX_P HELX_P2 2 SER A 96 ? GLU A 102 ? SER A 96 GLU A 102 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 35 ? LEU A 36 ? PHE A 35 LEU A 36 A 2 VAL A 48 ? VAL A 51 ? VAL A 48 VAL A 51 A 3 SER A 58 ? ILE A 61 ? SER A 58 ILE A 61 B 1 ARG A 179 ? PRO A 183 ? ARG A 179 PRO A 183 B 2 TRP A 169 ? GLU A 173 ? TRP A 169 GLU A 173 B 3 ILE A 158 ? ASP A 163 ? ILE A 158 ASP A 163 B 4 TYR A 136 ? ALA A 139 ? TYR A 136 ALA A 139 B 5 VAL A 187 ? LYS A 189 ? VAL A 187 LYS A 189 C 1 LYS A 265 ? ILE A 269 ? LYS A 265 ILE A 269 C 2 TRP A 275 ? CYS A 279 ? TRP A 275 CYS A 279 C 3 LYS A 282 ? HIS A 285 ? LYS A 282 HIS A 285 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 36 ? N LEU A 36 O SER A 50 ? O SER A 50 A 2 3 N LEU A 49 ? N LEU A 49 O TYR A 60 ? O TYR A 60 B 1 2 O ILE A 182 ? O ILE A 182 N TRP A 170 ? N TRP A 170 B 2 3 O ASN A 171 ? O ASN A 171 N ASP A 163 ? N ASP A 163 B 3 4 O LEU A 159 ? O LEU A 159 N VAL A 137 ? N VAL A 137 B 4 5 N ARG A 138 ? N ARG A 138 O GLU A 188 ? O GLU A 188 C 1 2 N LYS A 268 ? N LYS A 268 O GLU A 276 ? O GLU A 276 C 2 3 N CYS A 279 ? N CYS A 279 O LYS A 282 ? O LYS A 282 # _database_PDB_matrix.entry_id 2EYZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EYZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 TRP 15 15 15 TRP TRP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 TRP 169 169 169 TRP TRP A . n A 1 170 TRP 170 170 170 TRP TRP A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 MET 181 181 181 MET MET A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 SER 198 198 198 SER SER A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 ASN 204 204 204 ASN ASN A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 HIS 209 209 209 HIS HIS A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 GLN 211 211 211 GLN GLN A . n A 1 212 PRO 212 212 212 PRO PRO A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 PRO 218 218 218 PRO PRO A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 TYR 221 221 221 TYR TYR A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 ASN 227 227 227 ASN ASN A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 PRO 231 231 231 PRO PRO A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 GLN 234 234 234 GLN GLN A . n A 1 235 ASN 235 235 235 ASN ASN A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 PRO 237 237 237 PRO PRO A . n A 1 238 ILE 238 238 238 ILE ILE A . n A 1 239 TYR 239 239 239 TYR TYR A . n A 1 240 ALA 240 240 240 ALA ALA A . n A 1 241 ARG 241 241 241 ARG ARG A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 ILE 243 243 243 ILE ILE A . n A 1 244 GLN 244 244 244 GLN GLN A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 ASN 249 249 249 ASN ASN A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 ASP 252 252 252 ASP ASP A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 ALA 255 255 255 ALA ALA A . n A 1 256 LEU 256 256 256 LEU LEU A . n A 1 257 ALA 257 257 257 ALA ALA A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 GLY 261 261 261 GLY GLY A . n A 1 262 GLU 262 262 262 GLU GLU A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 VAL 264 264 264 VAL VAL A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 THR 267 267 267 THR THR A . n A 1 268 LYS 268 268 268 LYS LYS A . n A 1 269 ILE 269 269 269 ILE ILE A . n A 1 270 ASN 270 270 270 ASN ASN A . n A 1 271 VAL 271 271 271 VAL VAL A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 GLY 273 273 273 GLY GLY A . n A 1 274 GLN 274 274 274 GLN GLN A . n A 1 275 TRP 275 275 275 TRP TRP A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 GLU 278 278 278 GLU GLU A . n A 1 279 CYS 279 279 279 CYS CYS A . n A 1 280 ASN 280 280 280 ASN ASN A . n A 1 281 GLY 281 281 281 GLY GLY A . n A 1 282 LYS 282 282 282 LYS LYS A . n A 1 283 ARG 283 283 283 ARG ARG A . n A 1 284 GLY 284 284 284 GLY GLY A . n A 1 285 HIS 285 285 285 HIS HIS A . n A 1 286 PHE 286 286 286 PHE PHE A . n A 1 287 PRO 287 287 287 PRO PRO A . n A 1 288 PHE 288 288 288 PHE PHE A . n A 1 289 THR 289 289 289 THR THR A . n A 1 290 HIS 290 290 290 HIS HIS A . n A 1 291 VAL 291 291 291 VAL VAL A . n A 1 292 ARG 292 292 292 ARG ARG A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 GLN 296 296 296 GLN GLN A . n A 1 297 GLN 297 297 297 GLN GLN A . n A 1 298 ASN 298 298 298 ASN ASN A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 GLU 300 300 300 GLU GLU A . n A 1 301 GLU 301 301 301 GLU GLU A . n A 1 302 ASP 302 302 302 ASP ASP A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 SER 304 304 304 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-11-10 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLN 21 ? ? H A ALA 25 ? ? 1.43 2 1 O A GLN 28 ? ? H A GLN 30 ? ? 1.50 3 1 O A THR 111 ? ? HG1 A THR 112 ? ? 1.53 4 1 O A VAL 137 ? ? H A LEU 159 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -76.68 -167.49 2 1 ASN A 4 ? ? -164.88 -49.08 3 1 PHE A 5 ? ? 49.72 174.60 4 1 SER A 7 ? ? -146.53 -68.67 5 1 GLU A 8 ? ? -132.01 -88.72 6 1 GLU A 9 ? ? 48.34 -69.41 7 1 ARG A 10 ? ? -93.03 51.01 8 1 SER A 11 ? ? -108.59 -72.66 9 1 SER A 12 ? ? -158.70 -146.14 10 1 TYR A 14 ? ? 176.41 -33.51 11 1 TRP A 15 ? ? 59.16 164.14 12 1 ARG A 17 ? ? -55.04 86.88 13 1 ARG A 20 ? ? -170.27 -41.92 14 1 GLN A 28 ? ? -59.17 -120.97 15 1 ARG A 31 ? ? -51.74 171.00 16 1 SER A 40 ? ? -166.04 61.61 17 1 THR A 42 ? ? -66.77 -176.05 18 1 SER A 43 ? ? 78.59 -175.74 19 1 GLU A 53 ? ? -169.79 -59.12 20 1 ASN A 54 ? ? -160.57 -57.89 21 1 ARG A 56 ? ? 49.30 167.22 22 1 PRO A 67 ? ? -42.91 167.26 23 1 ALA A 76 ? ? -110.89 -73.76 24 1 SER A 83 ? ? 174.42 166.88 25 1 SER A 85 ? ? -54.30 -109.32 26 1 ARG A 86 ? ? 61.59 135.26 27 1 ILE A 89 ? ? 148.85 137.93 28 1 ASP A 91 ? ? 48.00 29.01 29 1 PHE A 94 ? ? -99.39 -113.82 30 1 ASP A 95 ? ? -168.53 -35.78 31 1 GLU A 102 ? ? -80.25 44.40 32 1 ILE A 106 ? ? -107.66 -60.20 33 1 HIS A 107 ? ? -166.22 104.73 34 1 TYR A 108 ? ? 43.46 -169.78 35 1 THR A 112 ? ? 99.04 -172.55 36 1 LEU A 114 ? ? 60.01 93.08 37 1 SER A 119 ? ? -61.66 -145.79 38 1 ARG A 120 ? ? -98.74 -67.40 39 1 SER A 121 ? ? 46.94 -153.74 40 1 ARG A 122 ? ? 45.54 21.33 41 1 GLN A 123 ? ? 65.22 89.93 42 1 LEU A 129 ? ? -165.31 58.38 43 1 ALA A 134 ? ? -175.95 -151.35 44 1 ASN A 144 ? ? 169.01 135.69 45 1 ASN A 146 ? ? -156.33 -42.42 46 1 LYS A 155 ? ? -38.80 136.33 47 1 ASP A 163 ? ? 172.82 157.93 48 1 PRO A 192 ? ? -74.78 -78.55 49 1 ALA A 193 ? ? -174.99 -47.51 50 1 ALA A 195 ? ? -140.65 -39.96 51 1 VAL A 197 ? ? -144.18 -45.21 52 1 SER A 198 ? ? 55.74 -167.00 53 1 ALA A 199 ? ? -88.72 -77.94 54 1 LEU A 200 ? ? -177.18 -59.01 55 1 ILE A 201 ? ? 68.62 -68.17 56 1 ASN A 204 ? ? -146.43 -58.29 57 1 PRO A 212 ? ? -69.96 64.03 58 1 ALA A 222 ? ? -161.55 104.21 59 1 PRO A 224 ? ? -52.31 -168.06 60 1 SER A 225 ? ? -54.46 84.80 61 1 LEU A 230 ? ? -120.61 -67.53 62 1 LEU A 233 ? ? -174.73 42.38 63 1 PRO A 237 ? ? -52.68 -162.54 64 1 ALA A 240 ? ? -163.48 -96.04 65 1 LYS A 253 ? ? -136.20 -68.83 66 1 LYS A 268 ? ? 83.77 100.99 67 1 SER A 272 ? ? -79.08 30.21 68 1 LEU A 293 ? ? -57.79 174.54 69 1 ASP A 295 ? ? 164.30 -81.96 70 1 GLN A 296 ? ? -143.17 52.24 #