data_2FWT # _entry.id 2FWT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2FWT RCSB RCSB036406 WWPDB D_1000036406 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2FW5 _pdbx_database_related.details 'Crystal structure of the recombinant protein' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FWT _pdbx_database_status.recvd_initial_deposition_date 2006-02-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Leys, D.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Structural and Functional Studies on DHC, the Diheme Cytochrome c from Rhodobacter sphaeroides, and Its Interaction with SHP, the sphaeroides Heme Protein ; _citation.journal_abbrev Biochemistry _citation.journal_volume 45 _citation.page_first 6363 _citation.page_last 6371 _citation.year 2006 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16700547 _citation.pdbx_database_id_DOI 10.1021/bi060288q # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gibson, H.R.' 1 ? primary 'Mowat, C.G.' 2 ? primary 'Miles, C.S.' 3 ? primary 'Li, B.R.' 4 ? primary 'Leys, D.' 5 ? primary 'Reid, G.A.' 6 ? primary 'Chapman, S.K.' 7 ? # _cell.entry_id 2FWT _cell.length_a 72.790 _cell.length_b 72.790 _cell.length_c 51.484 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2FWT _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'DHC, diheme cytochrome c' 13517.294 1 ? ? 'residues 12-136' ? 2 non-polymer syn 'HEME C' 618.503 2 ? ? ? ? 3 water nat water 18.015 115 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ALVVTDPLTRTECSACHMAYPAALLPARSWTALMADLPNHFGEDASLDEASRGQIESYLVANAADSSGAGRALRGLVQTD TPLRISELPWFKRKHADEVSPRMLEKARSMSNCAACHTGAERGLF ; _entity_poly.pdbx_seq_one_letter_code_can ;ALVVTDPLTRTECSACHMAYPAALLPARSWTALMADLPNHFGEDASLDEASRGQIESYLVANAADSSGAGRALRGLVQTD TPLRISELPWFKRKHADEVSPRMLEKARSMSNCAACHTGAERGLF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 VAL n 1 4 VAL n 1 5 THR n 1 6 ASP n 1 7 PRO n 1 8 LEU n 1 9 THR n 1 10 ARG n 1 11 THR n 1 12 GLU n 1 13 CYS n 1 14 SER n 1 15 ALA n 1 16 CYS n 1 17 HIS n 1 18 MET n 1 19 ALA n 1 20 TYR n 1 21 PRO n 1 22 ALA n 1 23 ALA n 1 24 LEU n 1 25 LEU n 1 26 PRO n 1 27 ALA n 1 28 ARG n 1 29 SER n 1 30 TRP n 1 31 THR n 1 32 ALA n 1 33 LEU n 1 34 MET n 1 35 ALA n 1 36 ASP n 1 37 LEU n 1 38 PRO n 1 39 ASN n 1 40 HIS n 1 41 PHE n 1 42 GLY n 1 43 GLU n 1 44 ASP n 1 45 ALA n 1 46 SER n 1 47 LEU n 1 48 ASP n 1 49 GLU n 1 50 ALA n 1 51 SER n 1 52 ARG n 1 53 GLY n 1 54 GLN n 1 55 ILE n 1 56 GLU n 1 57 SER n 1 58 TYR n 1 59 LEU n 1 60 VAL n 1 61 ALA n 1 62 ASN n 1 63 ALA n 1 64 ALA n 1 65 ASP n 1 66 SER n 1 67 SER n 1 68 GLY n 1 69 ALA n 1 70 GLY n 1 71 ARG n 1 72 ALA n 1 73 LEU n 1 74 ARG n 1 75 GLY n 1 76 LEU n 1 77 VAL n 1 78 GLN n 1 79 THR n 1 80 ASP n 1 81 THR n 1 82 PRO n 1 83 LEU n 1 84 ARG n 1 85 ILE n 1 86 SER n 1 87 GLU n 1 88 LEU n 1 89 PRO n 1 90 TRP n 1 91 PHE n 1 92 LYS n 1 93 ARG n 1 94 LYS n 1 95 HIS n 1 96 ALA n 1 97 ASP n 1 98 GLU n 1 99 VAL n 1 100 SER n 1 101 PRO n 1 102 ARG n 1 103 MET n 1 104 LEU n 1 105 GLU n 1 106 LYS n 1 107 ALA n 1 108 ARG n 1 109 SER n 1 110 MET n 1 111 SER n 1 112 ASN n 1 113 CYS n 1 114 ALA n 1 115 ALA n 1 116 CYS n 1 117 HIS n 1 118 THR n 1 119 GLY n 1 120 ALA n 1 121 GLU n 1 122 ARG n 1 123 GLY n 1 124 LEU n 1 125 PHE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Rhodobacter sphaeroides' _entity_src_nat.pdbx_ncbi_taxonomy_id 1063 _entity_src_nat.genus Rhodobacter _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q3J4W3_RHOS4 _struct_ref.pdbx_db_accession Q3J4W3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ALVVTDPLTRTECSACHMAYPAALLPARSWTALMADLPNHFGEDASLDEASRGQIESYLVANAADSSGAGRALRGLVQTD TPLRISELPWFKRKHADEVSPRMLEKARSMSNCAACHTGAERGLF ; _struct_ref.pdbx_align_begin 34 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FWT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 125 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q3J4W3 _struct_ref_seq.db_align_beg 34 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 158 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 136 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2FWT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.91 _exptl_crystal.density_percent_sol 57.75 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details '20% PEG 3000, 0.2M ammonium acetate, 0.1M MES pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2001-09-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator diamond _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9 1.0 2 1.74 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM30A' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM30A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9, 1.74' # _reflns.entry_id 2FWT _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 30 _reflns.d_resolution_high 1.85 _reflns.number_obs 13408 _reflns.number_all 13408 _reflns.percent_possible_obs 95.2 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.4 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.85 _reflns_shell.d_res_low 1.95 _reflns_shell.percent_possible_all 94.3 _reflns_shell.Rmerge_I_obs 0.342 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.8 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2FWT _refine.ls_number_reflns_obs 12739 _refine.ls_number_reflns_all 12739 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.85 _refine.ls_percent_reflns_obs 100.00 _refine.ls_R_factor_obs 0.1519 _refine.ls_R_factor_all 0.1519 _refine.ls_R_factor_R_work 0.14987 _refine.ls_R_factor_R_free 0.19272 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 659 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.965 _refine.correlation_coeff_Fo_to_Fc_free 0.951 _refine.B_iso_mean 19.946 _refine.aniso_B[1][1] 0.77 _refine.aniso_B[2][2] 0.77 _refine.aniso_B[3][3] -1.15 _refine.aniso_B[1][2] 0.38 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.152 _refine.pdbx_overall_ESU_R_Free 0.103 _refine.overall_SU_ML 0.061 _refine.overall_SU_B 4.339 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 823 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 86 _refine_hist.number_atoms_solvent 115 _refine_hist.number_atoms_total 1024 _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.017 0.022 ? 945 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 808 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.594 2.237 ? 1308 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.958 3.000 ? 1863 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.107 5.000 ? 110 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 33.245 23.438 ? 32 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.528 15.000 ? 125 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 23.026 15.000 ? 5 'X-RAY DIFFRACTION' ? r_chiral_restr 0.120 0.200 ? 130 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1035 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 164 'X-RAY DIFFRACTION' ? r_nbd_refined 0.319 0.200 ? 218 'X-RAY DIFFRACTION' ? r_nbd_other 0.187 0.200 ? 778 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.176 0.200 ? 438 'X-RAY DIFFRACTION' ? r_nbtor_other 0.092 0.200 ? 450 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.117 0.200 ? 68 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.065 0.200 ? 5 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.318 0.200 ? 33 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.208 0.200 ? 16 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.555 1.500 ? 703 'X-RAY DIFFRACTION' ? r_mcbond_other 0.437 1.500 ? 225 'X-RAY DIFFRACTION' ? r_mcangle_it 1.998 2.000 ? 886 'X-RAY DIFFRACTION' ? r_scbond_it 2.560 3.000 ? 479 'X-RAY DIFFRACTION' ? r_scangle_it 3.344 4.500 ? 418 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 1.766 3.000 ? 2111 'X-RAY DIFFRACTION' ? r_sphericity_free 6.475 3.000 ? 115 'X-RAY DIFFRACTION' ? r_sphericity_bonded 1.776 3.000 ? 1717 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.850 _refine_ls_shell.d_res_low 1.898 _refine_ls_shell.number_reflns_R_work 897 _refine_ls_shell.R_factor_R_work 0.147 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.207 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 48 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2FWT _struct.title 'Crystal structure of DHC purified from Rhodobacter sphaeroides' _struct.pdbx_descriptor 'DHC, diheme cytochrome c' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FWT _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'cytochrome c, diheme protein, electron transfer, sphaeroides heme protein, oxygen-binding, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 6 ? CYS A 13 ? ASP A 17 CYS A 24 1 ? 8 HELX_P HELX_P2 2 PRO A 21 ? LEU A 25 ? PRO A 32 LEU A 36 5 ? 5 HELX_P HELX_P3 3 PRO A 26 ? ALA A 35 ? PRO A 37 ALA A 46 1 ? 10 HELX_P HELX_P4 4 ASP A 36 ? HIS A 40 ? ASP A 47 HIS A 51 5 ? 5 HELX_P HELX_P5 5 ASP A 48 ? ASN A 62 ? ASP A 59 ASN A 73 1 ? 15 HELX_P HELX_P6 6 ARG A 84 ? GLU A 87 ? ARG A 95 GLU A 98 5 ? 4 HELX_P HELX_P7 7 LEU A 88 ? VAL A 99 ? LEU A 99 VAL A 110 1 ? 12 HELX_P HELX_P8 8 SER A 100 ? ARG A 108 ? SER A 111 ARG A 119 1 ? 9 HELX_P HELX_P9 9 ASN A 112 ? CYS A 116 ? ASN A 123 CYS A 127 5 ? 5 HELX_P HELX_P10 10 GLY A 119 ? GLY A 123 ? GLY A 130 GLY A 134 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B HEC . FE ? ? ? 1_555 A HIS 95 NE2 ? ? A HEC 803 A HIS 106 1_555 ? ? ? ? ? ? ? 1.974 ? metalc2 metalc ? ? B HEC . FE ? ? ? 1_555 A HIS 117 NE2 ? ? A HEC 803 A HIS 128 1_555 ? ? ? ? ? ? ? 1.973 ? metalc3 metalc ? ? C HEC . FE ? ? ? 1_555 A HIS 17 NE2 ? ? A HEC 805 A HIS 28 1_555 ? ? ? ? ? ? ? 1.975 ? metalc4 metalc ? ? C HEC . FE ? ? ? 1_555 A HIS 40 NE2 ? ? A HEC 805 A HIS 51 1_555 ? ? ? ? ? ? ? 1.955 ? covale1 covale none ? A CYS 13 SG ? ? ? 1_555 C HEC . CAB ? ? A CYS 24 A HEC 805 1_555 ? ? ? ? ? ? ? 2.070 ? covale2 covale none ? A CYS 16 SG ? ? ? 1_555 C HEC . CAC ? ? A CYS 27 A HEC 805 1_555 ? ? ? ? ? ? ? 2.067 ? covale3 covale none ? A CYS 113 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 124 A HEC 803 1_555 ? ? ? ? ? ? ? 2.006 ? covale4 covale none ? A CYS 116 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 127 A HEC 803 1_555 ? ? ? ? ? ? ? 2.043 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM A 803' AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM A 805' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 PHE A 91 ? PHE A 102 . ? 1_555 ? 2 AC1 16 LYS A 94 ? LYS A 105 . ? 1_555 ? 3 AC1 16 HIS A 95 ? HIS A 106 . ? 1_555 ? 4 AC1 16 GLU A 98 ? GLU A 109 . ? 1_555 ? 5 AC1 16 SER A 100 ? SER A 111 . ? 3_774 ? 6 AC1 16 ARG A 102 ? ARG A 113 . ? 3_774 ? 7 AC1 16 MET A 103 ? MET A 114 . ? 3_774 ? 8 AC1 16 MET A 110 ? MET A 121 . ? 1_555 ? 9 AC1 16 ASN A 112 ? ASN A 123 . ? 1_555 ? 10 AC1 16 CYS A 113 ? CYS A 124 . ? 1_555 ? 11 AC1 16 CYS A 116 ? CYS A 127 . ? 1_555 ? 12 AC1 16 HIS A 117 ? HIS A 128 . ? 1_555 ? 13 AC1 16 PHE A 125 ? PHE A 136 . ? 1_555 ? 14 AC1 16 HOH D . ? HOH A 827 . ? 1_555 ? 15 AC1 16 HOH D . ? HOH A 874 . ? 1_555 ? 16 AC1 16 HOH D . ? HOH A 907 . ? 1_555 ? 17 AC2 16 CYS A 13 ? CYS A 24 . ? 1_555 ? 18 AC2 16 CYS A 16 ? CYS A 27 . ? 1_555 ? 19 AC2 16 HIS A 17 ? HIS A 28 . ? 1_555 ? 20 AC2 16 TYR A 20 ? TYR A 31 . ? 1_555 ? 21 AC2 16 LEU A 33 ? LEU A 44 . ? 1_555 ? 22 AC2 16 HIS A 40 ? HIS A 51 . ? 1_555 ? 23 AC2 16 PHE A 41 ? PHE A 52 . ? 1_555 ? 24 AC2 16 GLU A 43 ? GLU A 54 . ? 1_555 ? 25 AC2 16 ALA A 45 ? ALA A 56 . ? 1_555 ? 26 AC2 16 ARG A 84 ? ARG A 95 . ? 1_555 ? 27 AC2 16 ILE A 85 ? ILE A 96 . ? 1_555 ? 28 AC2 16 SER A 86 ? SER A 97 . ? 1_555 ? 29 AC2 16 SER A 109 ? SER A 120 . ? 1_555 ? 30 AC2 16 SER A 111 ? SER A 122 . ? 1_555 ? 31 AC2 16 HOH D . ? HOH A 880 . ? 1_555 ? 32 AC2 16 HOH D . ? HOH A 884 . ? 1_555 ? # _database_PDB_matrix.entry_id 2FWT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FWT _atom_sites.fract_transf_matrix[1][1] 0.013738 _atom_sites.fract_transf_matrix[1][2] 0.007932 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015863 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019424 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 12 ? ? ? A . n A 1 2 LEU 2 13 13 LEU LEU A . n A 1 3 VAL 3 14 14 VAL VAL A . n A 1 4 VAL 4 15 15 VAL VAL A . n A 1 5 THR 5 16 16 THR THR A . n A 1 6 ASP 6 17 17 ASP ASP A . n A 1 7 PRO 7 18 18 PRO PRO A . n A 1 8 LEU 8 19 19 LEU LEU A . n A 1 9 THR 9 20 20 THR THR A . n A 1 10 ARG 10 21 21 ARG ARG A . n A 1 11 THR 11 22 22 THR THR A . n A 1 12 GLU 12 23 23 GLU GLU A . n A 1 13 CYS 13 24 24 CYS CYS A . n A 1 14 SER 14 25 25 SER SER A . n A 1 15 ALA 15 26 26 ALA GLY A . n A 1 16 CYS 16 27 27 CYS CYS A . n A 1 17 HIS 17 28 28 HIS HIS A . n A 1 18 MET 18 29 29 MET MET A . n A 1 19 ALA 19 30 30 ALA ALA A . n A 1 20 TYR 20 31 31 TYR TYR A . n A 1 21 PRO 21 32 32 PRO PRO A . n A 1 22 ALA 22 33 33 ALA ALA A . n A 1 23 ALA 23 34 34 ALA ALA A . n A 1 24 LEU 24 35 35 LEU LEU A . n A 1 25 LEU 25 36 36 LEU LEU A . n A 1 26 PRO 26 37 37 PRO PRO A . n A 1 27 ALA 27 38 38 ALA ALA A . n A 1 28 ARG 28 39 39 ARG ARG A . n A 1 29 SER 29 40 40 SER SER A . n A 1 30 TRP 30 41 41 TRP TRP A . n A 1 31 THR 31 42 42 THR THR A . n A 1 32 ALA 32 43 43 ALA ALA A . n A 1 33 LEU 33 44 44 LEU LEU A . n A 1 34 MET 34 45 45 MET MET A . n A 1 35 ALA 35 46 46 ALA ALA A . n A 1 36 ASP 36 47 47 ASP ASP A . n A 1 37 LEU 37 48 48 LEU LEU A . n A 1 38 PRO 38 49 49 PRO PRO A . n A 1 39 ASN 39 50 50 ASN ASN A . n A 1 40 HIS 40 51 51 HIS HIS A . n A 1 41 PHE 41 52 52 PHE PHE A . n A 1 42 GLY 42 53 53 GLY GLY A . n A 1 43 GLU 43 54 54 GLU GLU A . n A 1 44 ASP 44 55 55 ASP ASP A . n A 1 45 ALA 45 56 56 ALA ALA A . n A 1 46 SER 46 57 57 SER SER A . n A 1 47 LEU 47 58 58 LEU LEU A . n A 1 48 ASP 48 59 59 ASP ASP A . n A 1 49 GLU 49 60 60 GLU GLU A . n A 1 50 ALA 50 61 61 ALA ALA A . n A 1 51 SER 51 62 62 SER SER A . n A 1 52 ARG 52 63 63 ARG ARG A . n A 1 53 GLY 53 64 64 GLY GLY A . n A 1 54 GLN 54 65 65 GLN GLN A . n A 1 55 ILE 55 66 66 ILE ILE A . n A 1 56 GLU 56 67 67 GLU GLU A . n A 1 57 SER 57 68 68 SER SER A . n A 1 58 TYR 58 69 69 TYR TYR A . n A 1 59 LEU 59 70 70 LEU LEU A . n A 1 60 VAL 60 71 71 VAL VAL A . n A 1 61 ALA 61 72 72 ALA ALA A . n A 1 62 ASN 62 73 73 ASN ASN A . n A 1 63 ALA 63 74 74 ALA ALA A . n A 1 64 ALA 64 75 75 ALA ALA A . n A 1 65 ASP 65 76 76 ASP ASP A . n A 1 66 SER 66 77 77 SER SER A . n A 1 67 SER 67 78 78 SER ALA A . n A 1 68 GLY 68 79 79 GLY GLY A . n A 1 69 ALA 69 80 ? ? ? A . n A 1 70 GLY 70 81 ? ? ? A . n A 1 71 ARG 71 82 ? ? ? A . n A 1 72 ALA 72 83 ? ? ? A . n A 1 73 LEU 73 84 ? ? ? A . n A 1 74 ARG 74 85 ? ? ? A . n A 1 75 GLY 75 86 ? ? ? A . n A 1 76 LEU 76 87 ? ? ? A . n A 1 77 VAL 77 88 ? ? ? A . n A 1 78 GLN 78 89 ? ? ? A . n A 1 79 THR 79 90 ? ? ? A . n A 1 80 ASP 80 91 ? ? ? A . n A 1 81 THR 81 92 92 THR THR A . n A 1 82 PRO 82 93 93 PRO PRO A . n A 1 83 LEU 83 94 94 LEU LEU A . n A 1 84 ARG 84 95 95 ARG ARG A . n A 1 85 ILE 85 96 96 ILE ILE A . n A 1 86 SER 86 97 97 SER SER A . n A 1 87 GLU 87 98 98 GLU GLU A . n A 1 88 LEU 88 99 99 LEU LEU A . n A 1 89 PRO 89 100 100 PRO PRO A . n A 1 90 TRP 90 101 101 TRP TRP A . n A 1 91 PHE 91 102 102 PHE PHE A . n A 1 92 LYS 92 103 103 LYS LYS A . n A 1 93 ARG 93 104 104 ARG ARG A . n A 1 94 LYS 94 105 105 LYS LYS A . n A 1 95 HIS 95 106 106 HIS HIS A . n A 1 96 ALA 96 107 107 ALA ALA A . n A 1 97 ASP 97 108 108 ASP ASP A . n A 1 98 GLU 98 109 109 GLU GLU A . n A 1 99 VAL 99 110 110 VAL VAL A . n A 1 100 SER 100 111 111 SER SER A . n A 1 101 PRO 101 112 112 PRO PRO A . n A 1 102 ARG 102 113 113 ARG SER A . n A 1 103 MET 103 114 114 MET MET A . n A 1 104 LEU 104 115 115 LEU LEU A . n A 1 105 GLU 105 116 116 GLU SER A . n A 1 106 LYS 106 117 117 LYS SER A . n A 1 107 ALA 107 118 118 ALA ALA A . n A 1 108 ARG 108 119 119 ARG SER A . n A 1 109 SER 109 120 120 SER SER A . n A 1 110 MET 110 121 121 MET MET A . n A 1 111 SER 111 122 122 SER SER A . n A 1 112 ASN 112 123 123 ASN ASN A . n A 1 113 CYS 113 124 124 CYS CYS A . n A 1 114 ALA 114 125 125 ALA ALA A . n A 1 115 ALA 115 126 126 ALA ALA A . n A 1 116 CYS 116 127 127 CYS CYS A . n A 1 117 HIS 117 128 128 HIS HIS A . n A 1 118 THR 118 129 129 THR THR A . n A 1 119 GLY 119 130 130 GLY GLY A . n A 1 120 ALA 120 131 131 ALA ALA A . n A 1 121 GLU 121 132 132 GLU ALA A . n A 1 122 ARG 122 133 133 ARG ALA A . n A 1 123 GLY 123 134 134 GLY GLY A . n A 1 124 LEU 124 135 135 LEU LEU A . n A 1 125 PHE 125 136 136 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 803 803 HEC HEM A . C 2 HEC 1 805 805 HEC HEM A . D 3 HOH 1 806 1 HOH HOH A . D 3 HOH 2 807 2 HOH HOH A . D 3 HOH 3 808 3 HOH HOH A . D 3 HOH 4 809 4 HOH HOH A . D 3 HOH 5 810 5 HOH HOH A . D 3 HOH 6 811 6 HOH HOH A . D 3 HOH 7 812 7 HOH HOH A . D 3 HOH 8 813 8 HOH HOH A . D 3 HOH 9 814 9 HOH HOH A . D 3 HOH 10 815 10 HOH HOH A . D 3 HOH 11 816 11 HOH HOH A . D 3 HOH 12 817 12 HOH HOH A . D 3 HOH 13 818 13 HOH HOH A . D 3 HOH 14 819 14 HOH HOH A . D 3 HOH 15 820 15 HOH HOH A . D 3 HOH 16 821 16 HOH HOH A . D 3 HOH 17 822 17 HOH HOH A . D 3 HOH 18 823 18 HOH HOH A . D 3 HOH 19 824 19 HOH HOH A . D 3 HOH 20 825 20 HOH HOH A . D 3 HOH 21 826 21 HOH HOH A . D 3 HOH 22 827 22 HOH HOH A . D 3 HOH 23 828 23 HOH HOH A . D 3 HOH 24 829 24 HOH HOH A . D 3 HOH 25 830 25 HOH HOH A . D 3 HOH 26 831 26 HOH HOH A . D 3 HOH 27 832 27 HOH HOH A . D 3 HOH 28 833 28 HOH HOH A . D 3 HOH 29 834 29 HOH HOH A . D 3 HOH 30 835 30 HOH HOH A . D 3 HOH 31 836 31 HOH HOH A . D 3 HOH 32 837 32 HOH HOH A . D 3 HOH 33 838 33 HOH HOH A . D 3 HOH 34 839 34 HOH HOH A . D 3 HOH 35 840 35 HOH HOH A . D 3 HOH 36 841 36 HOH HOH A . D 3 HOH 37 842 37 HOH HOH A . D 3 HOH 38 843 38 HOH HOH A . D 3 HOH 39 844 39 HOH HOH A . D 3 HOH 40 845 40 HOH HOH A . D 3 HOH 41 846 41 HOH HOH A . D 3 HOH 42 847 42 HOH HOH A . D 3 HOH 43 848 43 HOH HOH A . D 3 HOH 44 849 44 HOH HOH A . D 3 HOH 45 850 45 HOH HOH A . D 3 HOH 46 851 46 HOH HOH A . D 3 HOH 47 852 47 HOH HOH A . D 3 HOH 48 853 48 HOH HOH A . D 3 HOH 49 854 49 HOH HOH A . D 3 HOH 50 855 50 HOH HOH A . D 3 HOH 51 856 51 HOH HOH A . D 3 HOH 52 857 52 HOH HOH A . D 3 HOH 53 858 53 HOH HOH A . D 3 HOH 54 859 54 HOH HOH A . D 3 HOH 55 860 55 HOH HOH A . D 3 HOH 56 861 56 HOH HOH A . D 3 HOH 57 862 57 HOH HOH A . D 3 HOH 58 863 58 HOH HOH A . D 3 HOH 59 864 59 HOH HOH A . D 3 HOH 60 865 60 HOH HOH A . D 3 HOH 61 866 61 HOH HOH A . D 3 HOH 62 867 62 HOH HOH A . D 3 HOH 63 868 63 HOH HOH A . D 3 HOH 64 869 64 HOH HOH A . D 3 HOH 65 870 65 HOH HOH A . D 3 HOH 66 871 66 HOH HOH A . D 3 HOH 67 872 67 HOH HOH A . D 3 HOH 68 873 68 HOH HOH A . D 3 HOH 69 874 69 HOH HOH A . D 3 HOH 70 875 70 HOH HOH A . D 3 HOH 71 876 71 HOH HOH A . D 3 HOH 72 877 72 HOH HOH A . D 3 HOH 73 878 73 HOH HOH A . D 3 HOH 74 879 74 HOH HOH A . D 3 HOH 75 880 75 HOH HOH A . D 3 HOH 76 881 76 HOH HOH A . D 3 HOH 77 882 77 HOH HOH A . D 3 HOH 78 883 78 HOH HOH A . D 3 HOH 79 884 79 HOH HOH A . D 3 HOH 80 885 80 HOH HOH A . D 3 HOH 81 886 81 HOH HOH A . D 3 HOH 82 887 82 HOH HOH A . D 3 HOH 83 888 83 HOH HOH A . D 3 HOH 84 889 84 HOH HOH A . D 3 HOH 85 890 85 HOH HOH A . D 3 HOH 86 891 86 HOH HOH A . D 3 HOH 87 892 87 HOH HOH A . D 3 HOH 88 893 88 HOH HOH A . D 3 HOH 89 894 89 HOH HOH A . D 3 HOH 90 895 90 HOH HOH A . D 3 HOH 91 896 91 HOH HOH A . D 3 HOH 92 897 92 HOH HOH A . D 3 HOH 93 898 93 HOH HOH A . D 3 HOH 94 899 94 HOH HOH A . D 3 HOH 95 900 95 HOH HOH A . D 3 HOH 96 901 96 HOH HOH A . D 3 HOH 97 902 97 HOH HOH A . D 3 HOH 98 903 98 HOH HOH A . D 3 HOH 99 904 99 HOH HOH A . D 3 HOH 100 905 100 HOH HOH A . D 3 HOH 101 906 101 HOH HOH A . D 3 HOH 102 907 102 HOH HOH A . D 3 HOH 103 908 103 HOH HOH A . D 3 HOH 104 909 104 HOH HOH A . D 3 HOH 105 910 105 HOH HOH A . D 3 HOH 106 911 106 HOH HOH A . D 3 HOH 107 912 107 HOH HOH A . D 3 HOH 108 913 108 HOH HOH A . D 3 HOH 109 914 109 HOH HOH A . D 3 HOH 110 915 110 HOH HOH A . D 3 HOH 111 916 111 HOH HOH A . D 3 HOH 112 917 112 HOH HOH A . D 3 HOH 113 918 113 HOH HOH A . D 3 HOH 114 919 114 HOH HOH A . D 3 HOH 115 920 115 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 95 ? A HIS 106 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NA ? B HEC . ? A HEC 803 ? 1_555 90.5 ? 2 NE2 ? A HIS 95 ? A HIS 106 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NB ? B HEC . ? A HEC 803 ? 1_555 94.7 ? 3 NA ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NB ? B HEC . ? A HEC 803 ? 1_555 90.5 ? 4 NE2 ? A HIS 95 ? A HIS 106 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NC ? B HEC . ? A HEC 803 ? 1_555 92.2 ? 5 NA ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NC ? B HEC . ? A HEC 803 ? 1_555 177.3 ? 6 NB ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NC ? B HEC . ? A HEC 803 ? 1_555 89.6 ? 7 NE2 ? A HIS 95 ? A HIS 106 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 ND ? B HEC . ? A HEC 803 ? 1_555 87.7 ? 8 NA ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 ND ? B HEC . ? A HEC 803 ? 1_555 90.6 ? 9 NB ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 ND ? B HEC . ? A HEC 803 ? 1_555 177.3 ? 10 NC ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 ND ? B HEC . ? A HEC 803 ? 1_555 89.3 ? 11 NE2 ? A HIS 95 ? A HIS 106 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NE2 ? A HIS 117 ? A HIS 128 ? 1_555 175.0 ? 12 NA ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NE2 ? A HIS 117 ? A HIS 128 ? 1_555 88.4 ? 13 NB ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NE2 ? A HIS 117 ? A HIS 128 ? 1_555 90.1 ? 14 NC ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NE2 ? A HIS 117 ? A HIS 128 ? 1_555 88.9 ? 15 ND ? B HEC . ? A HEC 803 ? 1_555 FE ? B HEC . ? A HEC 803 ? 1_555 NE2 ? A HIS 117 ? A HIS 128 ? 1_555 87.4 ? 16 NE2 ? A HIS 17 ? A HIS 28 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NA ? C HEC . ? A HEC 805 ? 1_555 88.7 ? 17 NE2 ? A HIS 17 ? A HIS 28 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NB ? C HEC . ? A HEC 805 ? 1_555 89.6 ? 18 NA ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NB ? C HEC . ? A HEC 805 ? 1_555 88.7 ? 19 NE2 ? A HIS 17 ? A HIS 28 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NC ? C HEC . ? A HEC 805 ? 1_555 90.4 ? 20 NA ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NC ? C HEC . ? A HEC 805 ? 1_555 178.9 ? 21 NB ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NC ? C HEC . ? A HEC 805 ? 1_555 90.6 ? 22 NE2 ? A HIS 17 ? A HIS 28 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 ND ? C HEC . ? A HEC 805 ? 1_555 91.3 ? 23 NA ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 ND ? C HEC . ? A HEC 805 ? 1_555 91.1 ? 24 NB ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 ND ? C HEC . ? A HEC 805 ? 1_555 179.1 ? 25 NC ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 ND ? C HEC . ? A HEC 805 ? 1_555 89.5 ? 26 NE2 ? A HIS 17 ? A HIS 28 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NE2 ? A HIS 40 ? A HIS 51 ? 1_555 177.8 ? 27 NA ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NE2 ? A HIS 40 ? A HIS 51 ? 1_555 91.7 ? 28 NB ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NE2 ? A HIS 40 ? A HIS 51 ? 1_555 88.3 ? 29 NC ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NE2 ? A HIS 40 ? A HIS 51 ? 1_555 89.1 ? 30 ND ? C HEC . ? A HEC 805 ? 1_555 FE ? C HEC . ? A HEC 805 ? 1_555 NE2 ? A HIS 40 ? A HIS 51 ? 1_555 90.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-05-23 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2019-10-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Non-polymer description' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' atom_site_anisotrop 3 4 'Structure model' chem_comp 4 4 'Structure model' entity 5 4 'Structure model' pdbx_entity_nonpoly 6 4 'Structure model' pdbx_nonpoly_scheme 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_atom_id' 6 4 'Structure model' '_atom_site.auth_comp_id' 7 4 'Structure model' '_atom_site.label_atom_id' 8 4 'Structure model' '_atom_site.label_comp_id' 9 4 'Structure model' '_atom_site.type_symbol' 10 4 'Structure model' '_atom_site_anisotrop.U[1][1]' 11 4 'Structure model' '_atom_site_anisotrop.U[1][2]' 12 4 'Structure model' '_atom_site_anisotrop.U[1][3]' 13 4 'Structure model' '_atom_site_anisotrop.U[2][2]' 14 4 'Structure model' '_atom_site_anisotrop.U[2][3]' 15 4 'Structure model' '_atom_site_anisotrop.U[3][3]' 16 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 17 4 'Structure model' '_atom_site_anisotrop.pdbx_auth_comp_id' 18 4 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 19 4 'Structure model' '_atom_site_anisotrop.pdbx_label_comp_id' 20 4 'Structure model' '_atom_site_anisotrop.type_symbol' 21 4 'Structure model' '_chem_comp.formula' 22 4 'Structure model' '_chem_comp.formula_weight' 23 4 'Structure model' '_chem_comp.id' 24 4 'Structure model' '_chem_comp.name' 25 4 'Structure model' '_chem_comp.pdbx_synonyms' 26 4 'Structure model' '_entity.formula_weight' 27 4 'Structure model' '_entity.pdbx_description' 28 4 'Structure model' '_pdbx_entity_nonpoly.comp_id' 29 4 'Structure model' '_pdbx_entity_nonpoly.name' 30 4 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 31 4 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 32 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 33 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 34 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 35 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 36 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 37 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 38 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 39 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 40 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 41 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 42 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 MLPHARE phasing . ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 850 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 862 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_675 _pdbx_validate_symm_contact.dist 2.03 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 47 ? ? -140.99 45.66 2 1 ARG A 119 ? ? 71.26 -31.61 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ALA 26 ? CB ? A ALA 15 CB 2 1 Y 1 A SER 78 ? OG ? A SER 67 OG 3 1 Y 1 A ARG 113 ? CD ? A ARG 102 CD 4 1 Y 1 A ARG 113 ? NE ? A ARG 102 NE 5 1 Y 1 A ARG 113 ? CZ ? A ARG 102 CZ 6 1 Y 1 A ARG 113 ? NH1 ? A ARG 102 NH1 7 1 Y 1 A ARG 113 ? NH2 ? A ARG 102 NH2 8 1 Y 1 A GLU 116 ? CD ? A GLU 105 CD 9 1 Y 1 A GLU 116 ? OE1 ? A GLU 105 OE1 10 1 Y 1 A GLU 116 ? OE2 ? A GLU 105 OE2 11 1 Y 1 A LYS 117 ? CD ? A LYS 106 CD 12 1 Y 1 A LYS 117 ? CE ? A LYS 106 CE 13 1 Y 1 A LYS 117 ? NZ ? A LYS 106 NZ 14 1 Y 1 A ARG 119 ? CD ? A ARG 108 CD 15 1 Y 1 A ARG 119 ? NE ? A ARG 108 NE 16 1 Y 1 A ARG 119 ? CZ ? A ARG 108 CZ 17 1 Y 1 A ARG 119 ? NH1 ? A ARG 108 NH1 18 1 Y 1 A ARG 119 ? NH2 ? A ARG 108 NH2 19 1 Y 1 A GLU 132 ? CG ? A GLU 121 CG 20 1 Y 1 A GLU 132 ? CD ? A GLU 121 CD 21 1 Y 1 A GLU 132 ? OE1 ? A GLU 121 OE1 22 1 Y 1 A GLU 132 ? OE2 ? A GLU 121 OE2 23 1 Y 1 A ARG 133 ? CG ? A ARG 122 CG 24 1 Y 1 A ARG 133 ? CD ? A ARG 122 CD 25 1 Y 1 A ARG 133 ? NE ? A ARG 122 NE 26 1 Y 1 A ARG 133 ? CZ ? A ARG 122 CZ 27 1 Y 1 A ARG 133 ? NH1 ? A ARG 122 NH1 28 1 Y 1 A ARG 133 ? NH2 ? A ARG 122 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 12 ? A ALA 1 2 1 Y 1 A ALA 80 ? A ALA 69 3 1 Y 1 A GLY 81 ? A GLY 70 4 1 Y 1 A ARG 82 ? A ARG 71 5 1 Y 1 A ALA 83 ? A ALA 72 6 1 Y 1 A LEU 84 ? A LEU 73 7 1 Y 1 A ARG 85 ? A ARG 74 8 1 Y 1 A GLY 86 ? A GLY 75 9 1 Y 1 A LEU 87 ? A LEU 76 10 1 Y 1 A VAL 88 ? A VAL 77 11 1 Y 1 A GLN 89 ? A GLN 78 12 1 Y 1 A THR 90 ? A THR 79 13 1 Y 1 A ASP 91 ? A ASP 80 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HEME C' HEC 3 water HOH #