data_2G3J # _entry.id 2G3J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2G3J RCSB RCSB036643 WWPDB D_1000036643 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2G3I _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2G3J _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-02-20 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Diertavitian, S.' 1 'Kaneko, S.' 2 'Fujimoto, Z.' 3 'Kuno, A.' 4 'Johansson, E.' 5 'Lo Leggio, L.' 6 # _citation.id primary _citation.title 'Structure-based engineering of glucose specificity in a family 10 xylanase from Streptomyces olivaceoviridis E-86' _citation.journal_abbrev 'PROCESS BIOCHEM' _citation.journal_volume 47 _citation.page_first 358 _citation.page_last 365 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1359-5113 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI 10.1016/j.procbio.2011.06.002 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ichinose, H.' 1 ? primary 'Diertavitian, S.' 2 ? primary 'Fujimoto, Z.' 3 ? primary 'Kuno, A.' 4 ? primary 'Leggio, L.L.' 5 ? primary 'Kaneko, S.' 6 ? # _cell.length_a 119.953 _cell.length_b 119.953 _cell.length_c 55.216 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.entry_id 2G3J _cell.pdbx_unique_axis ? _cell.Z_PDB 6 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 63' _symmetry.entry_id 2G3J _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 173 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Xylanase 34034.383 1 3.2.1.8 Q88A/R275A 'catalytic domain' ? 2 branched man 'alpha-D-xylopyranose-(1-4)-alpha-D-xylopyranose' 282.245 2 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 6 ? ? ? ? 4 water nat water 18.015 76 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AESTLGAAAAQSGRYFGTAIASGKLGDSAYTTIASREFNMVTAENEMKIDATEPQRGQFNFSAGDRVYNWAVQNGKQVRG HTLAWHSAQPGWMQSLSGSTLRQAMIDHINGVMGHYKGKIAQWDVVNEAFSDDGSGGRRDSNLQRTGNDWIEVAFRTARA ADPAAKLCYNDYNIENWTWAKTQGVYNMVRDFKQRGVPIDCVGFQSHFNSGSPYNSNFRTTLQNFAALGVDVAITELDIQ GASSSTYAAVTNDCLAVSRCLGITVWGVRDTDSWASGDTPLLFNGDGSKKAAYTAVLNALNGGGSRSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;AESTLGAAAAQSGRYFGTAIASGKLGDSAYTTIASREFNMVTAENEMKIDATEPQRGQFNFSAGDRVYNWAVQNGKQVRG HTLAWHSAQPGWMQSLSGSTLRQAMIDHINGVMGHYKGKIAQWDVVNEAFSDDGSGGRRDSNLQRTGNDWIEVAFRTARA ADPAAKLCYNDYNIENWTWAKTQGVYNMVRDFKQRGVPIDCVGFQSHFNSGSPYNSNFRTTLQNFAALGVDVAITELDIQ GASSSTYAAVTNDCLAVSRCLGITVWGVRDTDSWASGDTPLLFNGDGSKKAAYTAVLNALNGGGSRSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 SER n 1 4 THR n 1 5 LEU n 1 6 GLY n 1 7 ALA n 1 8 ALA n 1 9 ALA n 1 10 ALA n 1 11 GLN n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 TYR n 1 16 PHE n 1 17 GLY n 1 18 THR n 1 19 ALA n 1 20 ILE n 1 21 ALA n 1 22 SER n 1 23 GLY n 1 24 LYS n 1 25 LEU n 1 26 GLY n 1 27 ASP n 1 28 SER n 1 29 ALA n 1 30 TYR n 1 31 THR n 1 32 THR n 1 33 ILE n 1 34 ALA n 1 35 SER n 1 36 ARG n 1 37 GLU n 1 38 PHE n 1 39 ASN n 1 40 MET n 1 41 VAL n 1 42 THR n 1 43 ALA n 1 44 GLU n 1 45 ASN n 1 46 GLU n 1 47 MET n 1 48 LYS n 1 49 ILE n 1 50 ASP n 1 51 ALA n 1 52 THR n 1 53 GLU n 1 54 PRO n 1 55 GLN n 1 56 ARG n 1 57 GLY n 1 58 GLN n 1 59 PHE n 1 60 ASN n 1 61 PHE n 1 62 SER n 1 63 ALA n 1 64 GLY n 1 65 ASP n 1 66 ARG n 1 67 VAL n 1 68 TYR n 1 69 ASN n 1 70 TRP n 1 71 ALA n 1 72 VAL n 1 73 GLN n 1 74 ASN n 1 75 GLY n 1 76 LYS n 1 77 GLN n 1 78 VAL n 1 79 ARG n 1 80 GLY n 1 81 HIS n 1 82 THR n 1 83 LEU n 1 84 ALA n 1 85 TRP n 1 86 HIS n 1 87 SER n 1 88 ALA n 1 89 GLN n 1 90 PRO n 1 91 GLY n 1 92 TRP n 1 93 MET n 1 94 GLN n 1 95 SER n 1 96 LEU n 1 97 SER n 1 98 GLY n 1 99 SER n 1 100 THR n 1 101 LEU n 1 102 ARG n 1 103 GLN n 1 104 ALA n 1 105 MET n 1 106 ILE n 1 107 ASP n 1 108 HIS n 1 109 ILE n 1 110 ASN n 1 111 GLY n 1 112 VAL n 1 113 MET n 1 114 GLY n 1 115 HIS n 1 116 TYR n 1 117 LYS n 1 118 GLY n 1 119 LYS n 1 120 ILE n 1 121 ALA n 1 122 GLN n 1 123 TRP n 1 124 ASP n 1 125 VAL n 1 126 VAL n 1 127 ASN n 1 128 GLU n 1 129 ALA n 1 130 PHE n 1 131 SER n 1 132 ASP n 1 133 ASP n 1 134 GLY n 1 135 SER n 1 136 GLY n 1 137 GLY n 1 138 ARG n 1 139 ARG n 1 140 ASP n 1 141 SER n 1 142 ASN n 1 143 LEU n 1 144 GLN n 1 145 ARG n 1 146 THR n 1 147 GLY n 1 148 ASN n 1 149 ASP n 1 150 TRP n 1 151 ILE n 1 152 GLU n 1 153 VAL n 1 154 ALA n 1 155 PHE n 1 156 ARG n 1 157 THR n 1 158 ALA n 1 159 ARG n 1 160 ALA n 1 161 ALA n 1 162 ASP n 1 163 PRO n 1 164 ALA n 1 165 ALA n 1 166 LYS n 1 167 LEU n 1 168 CYS n 1 169 TYR n 1 170 ASN n 1 171 ASP n 1 172 TYR n 1 173 ASN n 1 174 ILE n 1 175 GLU n 1 176 ASN n 1 177 TRP n 1 178 THR n 1 179 TRP n 1 180 ALA n 1 181 LYS n 1 182 THR n 1 183 GLN n 1 184 GLY n 1 185 VAL n 1 186 TYR n 1 187 ASN n 1 188 MET n 1 189 VAL n 1 190 ARG n 1 191 ASP n 1 192 PHE n 1 193 LYS n 1 194 GLN n 1 195 ARG n 1 196 GLY n 1 197 VAL n 1 198 PRO n 1 199 ILE n 1 200 ASP n 1 201 CYS n 1 202 VAL n 1 203 GLY n 1 204 PHE n 1 205 GLN n 1 206 SER n 1 207 HIS n 1 208 PHE n 1 209 ASN n 1 210 SER n 1 211 GLY n 1 212 SER n 1 213 PRO n 1 214 TYR n 1 215 ASN n 1 216 SER n 1 217 ASN n 1 218 PHE n 1 219 ARG n 1 220 THR n 1 221 THR n 1 222 LEU n 1 223 GLN n 1 224 ASN n 1 225 PHE n 1 226 ALA n 1 227 ALA n 1 228 LEU n 1 229 GLY n 1 230 VAL n 1 231 ASP n 1 232 VAL n 1 233 ALA n 1 234 ILE n 1 235 THR n 1 236 GLU n 1 237 LEU n 1 238 ASP n 1 239 ILE n 1 240 GLN n 1 241 GLY n 1 242 ALA n 1 243 SER n 1 244 SER n 1 245 SER n 1 246 THR n 1 247 TYR n 1 248 ALA n 1 249 ALA n 1 250 VAL n 1 251 THR n 1 252 ASN n 1 253 ASP n 1 254 CYS n 1 255 LEU n 1 256 ALA n 1 257 VAL n 1 258 SER n 1 259 ARG n 1 260 CYS n 1 261 LEU n 1 262 GLY n 1 263 ILE n 1 264 THR n 1 265 VAL n 1 266 TRP n 1 267 GLY n 1 268 VAL n 1 269 ARG n 1 270 ASP n 1 271 THR n 1 272 ASP n 1 273 SER n 1 274 TRP n 1 275 ALA n 1 276 SER n 1 277 GLY n 1 278 ASP n 1 279 THR n 1 280 PRO n 1 281 LEU n 1 282 LEU n 1 283 PHE n 1 284 ASN n 1 285 GLY n 1 286 ASP n 1 287 GLY n 1 288 SER n 1 289 LYS n 1 290 LYS n 1 291 ALA n 1 292 ALA n 1 293 TYR n 1 294 THR n 1 295 ALA n 1 296 VAL n 1 297 LEU n 1 298 ASN n 1 299 ALA n 1 300 LEU n 1 301 ASN n 1 302 GLY n 1 303 GLY n 1 304 GLY n 1 305 SER n 1 306 ARG n 1 307 SER n 1 308 HIS n 1 309 HIS n 1 310 HIS n 1 311 HIS n 1 312 HIS n 1 313 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain E-86 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces olivaceoviridis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1921 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7SI98_STROI _struct_ref.pdbx_db_accession Q7SI98 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;AESTLGAAAAQSGRYFGTAIASGKLGDSAYTTIASREFNMVTAENEMKIDATEPQRGQFNFSAGDRVYNWAVQNGKQVRG HTLAWHSQQPGWMQSLSGSTLRQAMIDHINGVMGHYKGKIAQWDVVNEAFSDDGSGGRRDSNLQRTGNDWIEVAFRTARA ADPAAKLCYNDYNIENWTWAKTQGVYNMVRDFKQRGVPIDCVGFQSHFNSGSPYNSNFRTTLQNFAALGVDVAITELDIQ GASSSTYAAVTNDCLAVSRCLGITVWGVRDTDSWRSGDTPLLFNGDGSKKAAYTAVLNALNGG ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2G3J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 303 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7SI98 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 303 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 303 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2G3J ALA A 88 ? UNP Q7SI98 GLN 88 'engineered mutation' 88 1 1 2G3J ALA A 275 ? UNP Q7SI98 ARG 275 'engineered mutation' 275 2 1 2G3J GLY A 304 ? UNP Q7SI98 ? ? 'expression tag' 304 3 1 2G3J SER A 305 ? UNP Q7SI98 ? ? 'expression tag' 305 4 1 2G3J ARG A 306 ? UNP Q7SI98 ? ? 'expression tag' 306 5 1 2G3J SER A 307 ? UNP Q7SI98 ? ? 'expression tag' 307 6 1 2G3J HIS A 308 ? UNP Q7SI98 ? ? 'expression tag' 308 7 1 2G3J HIS A 309 ? UNP Q7SI98 ? ? 'expression tag' 309 8 1 2G3J HIS A 310 ? UNP Q7SI98 ? ? 'expression tag' 310 9 1 2G3J HIS A 311 ? UNP Q7SI98 ? ? 'expression tag' 311 10 1 2G3J HIS A 312 ? UNP Q7SI98 ? ? 'expression tag' 312 11 1 2G3J HIS A 313 ? UNP Q7SI98 ? ? 'expression tag' 313 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XYS 'D-saccharide, alpha linking' . alpha-D-xylopyranose ? 'C5 H10 O5' 150.130 # _exptl.entry_id 2G3J _exptl.crystals_number ? _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.51 _exptl_crystal.density_percent_sol 64.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.temp 294 _exptl_crystal_grow.pdbx_details '2.1M ammonium dehydrogen phosphate, 0.1M Tris, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 294K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 ? ? 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2003-04-17 _diffrn_detector.details ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.monochromator _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_scattering_type 1 'SINGLE WAVELENGTH' ? 1 M x-ray 2 'SINGLE WAVELENGTH' ? 1 M x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_wavelength_list 0.999 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 # _reflns.entry_id 2G3J _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 30 _reflns.number_all ? _reflns.number_obs 12287 _reflns.percent_possible_obs 97.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.113 _reflns.pdbx_netI_over_sigmaI 12.5 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1,2 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.85 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 98.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_obs 4.8 _reflns_shell.pdbx_Rsym_value 0.347 _reflns_shell.pdbx_redundancy 2.9 _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1,2 # _refine.ls_d_res_high 2.700 _refine.ls_d_res_low 20.000 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 95.670 _refine.ls_number_reflns_obs 12077 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_all 0.169 _refine.ls_R_factor_R_work 0.163 _refine.ls_R_factor_R_free 0.223 _refine.ls_percent_reflns_R_free 10.100 _refine.ls_number_reflns_R_free 1220 _refine.B_iso_mean 15.907 _refine.aniso_B[1][1] 0.810 _refine.aniso_B[2][2] 0.810 _refine.aniso_B[3][3] -1.210 _refine.aniso_B[1][2] 0.400 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.939 _refine.correlation_coeff_Fo_to_Fc_free 0.893 _refine.pdbx_overall_ESU_R 0.705 _refine.pdbx_overall_ESU_R_Free 0.300 _refine.overall_SU_ML 0.177 _refine.overall_SU_B 8.501 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.entry_id 2G3J _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_obs ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1,2 _refine.pdbx_overall_phase_error ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2301 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 68 _refine_hist.number_atoms_solvent 76 _refine_hist.number_atoms_total 2445 _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 20.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 2423 0.014 0.021 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 2037 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 3299 1.491 1.928 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 4716 0.871 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 300 7.305 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 117 32.189 24.188 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 358 14.629 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 16 20.315 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 359 0.081 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 2730 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 513 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 522 0.218 0.200 ? 'X-RAY DIFFRACTION' ? r_nbd_other 1941 0.182 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 1247 0.085 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 82 0.162 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 14 0.210 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 37 0.210 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 3 0.124 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1899 0.618 1.500 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 627 0.098 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2360 0.771 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 1121 1.310 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 939 2.095 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 2.700 _refine_ls_shell.d_res_low 2.769 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.number_reflns_R_work 778 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.204 _refine_ls_shell.R_factor_R_free 0.279 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 88 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 866 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2G3J _struct.title 'Structure of S.olivaceoviridis xylanase Q88A/R275A mutant' _struct.pdbx_descriptor Xylanase _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text 'glycoside hydrolase, HYDROLASE' _struct_keywords.entry_id 2G3J _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 4 ? SER A 12 ? THR A 4 SER A 12 1 ? 9 HELX_P HELX_P2 2 ALA A 21 ? LEU A 25 ? ALA A 21 LEU A 25 5 ? 5 HELX_P HELX_P3 3 ASP A 27 ? PHE A 38 ? ASP A 27 PHE A 38 1 ? 12 HELX_P HELX_P4 4 LYS A 48 ? GLU A 53 ? LYS A 48 GLU A 53 1 ? 6 HELX_P HELX_P5 5 PHE A 61 ? ASN A 74 ? PHE A 61 ASN A 74 1 ? 14 HELX_P HELX_P6 6 PRO A 90 ? SER A 95 ? PRO A 90 SER A 95 1 ? 6 HELX_P HELX_P7 7 SER A 97 ? TYR A 116 ? SER A 97 TYR A 116 1 ? 20 HELX_P HELX_P8 8 SER A 141 ? THR A 146 ? SER A 141 THR A 146 1 ? 6 HELX_P HELX_P9 9 ASP A 149 ? ASP A 162 ? ASP A 149 ASP A 162 1 ? 14 HELX_P HELX_P10 10 TRP A 179 ? GLY A 196 ? TRP A 179 GLY A 196 1 ? 18 HELX_P HELX_P11 11 ASN A 217 ? LEU A 228 ? ASN A 217 LEU A 228 1 ? 12 HELX_P HELX_P12 12 SER A 243 ? ALA A 256 ? SER A 243 ALA A 256 1 ? 14 HELX_P HELX_P13 13 ARG A 269 ? SER A 273 ? ARG A 269 SER A 273 5 ? 5 HELX_P HELX_P14 14 ALA A 275 ? THR A 279 ? ALA A 275 THR A 279 5 ? 5 HELX_P HELX_P15 15 LYS A 290 ? ASN A 301 ? LYS A 290 ASN A 301 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 168 SG B ? ? 1_555 A CYS 201 SG B ? A CYS 168 A CYS 201 1_555 ? ? ? ? ? ? ? 2.041 ? ? disulf2 disulf ? ? A CYS 254 SG ? ? ? 1_555 A CYS 260 SG ? ? A CYS 254 A CYS 260 1_555 ? ? ? ? ? ? ? 2.111 ? ? covale1 covale both ? B XYS . O4 ? ? ? 1_555 B XYS . C1 ? ? B XYS 1 B XYS 2 1_555 ? ? ? ? ? ? ? 1.443 ? ? covale2 covale both ? C XYS . O4 ? ? ? 1_555 C XYS . C1 ? ? C XYS 1 C XYS 2 1_555 ? ? ? ? ? ? ? 1.449 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id HIS _struct_mon_prot_cis.label_seq_id 81 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id HIS _struct_mon_prot_cis.auth_seq_id 81 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 THR _struct_mon_prot_cis.pdbx_label_seq_id_2 82 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 THR _struct_mon_prot_cis.pdbx_auth_seq_id_2 82 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.51 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel A 7 8 ? parallel A 8 9 ? parallel A 9 10 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 207 ? PHE A 208 ? HIS A 207 PHE A 208 A 2 ASP A 231 ? ILE A 239 ? ASP A 231 ILE A 239 A 3 CYS A 260 ? VAL A 265 ? CYS A 260 VAL A 265 A 4 TYR A 15 ? ILE A 20 ? TYR A 15 ILE A 20 A 5 MET A 40 ? ALA A 43 ? MET A 40 ALA A 43 A 6 GLN A 77 ? ALA A 84 ? GLN A 77 ALA A 84 A 7 GLN A 122 ? ASN A 127 ? GLN A 122 ASN A 127 A 8 LYS A 166 ? ASP A 171 ? LYS A 166 ASP A 171 A 9 CYS A 201 ? PHE A 204 ? CYS A 201 PHE A 204 A 10 ASP A 231 ? ILE A 239 ? ASP A 231 ILE A 239 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 208 ? N PHE A 208 O ASP A 238 ? O ASP A 238 A 2 3 N ILE A 234 ? N ILE A 234 O THR A 264 ? O THR A 264 A 3 4 O ILE A 263 ? O ILE A 263 N GLY A 17 ? N GLY A 17 A 4 5 N ILE A 20 ? N ILE A 20 O THR A 42 ? O THR A 42 A 5 6 N VAL A 41 ? N VAL A 41 O ARG A 79 ? O ARG A 79 A 6 7 N GLY A 80 ? N GLY A 80 O GLN A 122 ? O GLN A 122 A 7 8 N TRP A 123 ? N TRP A 123 O CYS A 168 ? O CYS A 168 A 8 9 N TYR A 169 ? N TYR A 169 O GLY A 203 ? O GLY A 203 A 9 10 N PHE A 204 ? N PHE A 204 O ALA A 233 ? O ALA A 233 # _atom_sites.entry_id 2G3J _atom_sites.fract_transf_matrix[1][1] 0.00834 _atom_sites.fract_transf_matrix[1][2] 0.00481 _atom_sites.fract_transf_matrix[1][3] 0.00000 _atom_sites.fract_transf_matrix[2][1] 0.00000 _atom_sites.fract_transf_matrix[2][2] 0.00963 _atom_sites.fract_transf_matrix[2][3] 0.00000 _atom_sites.fract_transf_matrix[3][1] 0.00000 _atom_sites.fract_transf_matrix[3][2] 0.00000 _atom_sites.fract_transf_matrix[3][3] 0.01811 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _database_PDB_caveat.id _database_PDB_caveat.text 1 'XYS B 1 HAS WRONG CHIRALITY AT ATOM C1' 2 'XYS B 2 HAS WRONG CHIRALITY AT ATOM C1' 3 'XYS C 1 HAS WRONG CHIRALITY AT ATOM C1' 4 'XYS C 2 HAS WRONG CHIRALITY AT ATOM C1' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 TRP 123 123 123 TRP TRP A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 TRP 150 150 150 TRP TRP A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 TRP 177 177 177 TRP TRP A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 MET 188 188 188 MET MET A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 GLN 194 194 194 GLN GLN A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 CYS 201 201 201 CYS CYS A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 PRO 213 213 213 PRO PRO A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 ASN 215 215 215 ASN ASN A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 ASN 217 217 217 ASN ASN A . n A 1 218 PHE 218 218 218 PHE PHE A . n A 1 219 ARG 219 219 219 ARG ARG A . n A 1 220 THR 220 220 220 THR THR A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 GLU 236 236 236 GLU GLU A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 GLN 240 240 240 GLN GLN A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 SER 244 244 244 SER SER A . n A 1 245 SER 245 245 245 SER SER A . n A 1 246 THR 246 246 246 THR THR A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 ALA 249 249 249 ALA ALA A . n A 1 250 VAL 250 250 250 VAL VAL A . n A 1 251 THR 251 251 251 THR THR A . n A 1 252 ASN 252 252 252 ASN ASN A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 CYS 254 254 254 CYS CYS A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 CYS 260 260 260 CYS CYS A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 THR 264 264 264 THR THR A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 TRP 266 266 266 TRP TRP A . n A 1 267 GLY 267 267 267 GLY GLY A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 ARG 269 269 269 ARG ARG A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 THR 271 271 271 THR THR A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 TRP 274 274 274 TRP TRP A . n A 1 275 ALA 275 275 275 ALA ALA A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 ASP 278 278 278 ASP ASP A . n A 1 279 THR 279 279 279 THR THR A . n A 1 280 PRO 280 280 280 PRO PRO A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 PHE 283 283 283 PHE PHE A . n A 1 284 ASN 284 284 284 ASN ASN A . n A 1 285 GLY 285 285 285 GLY GLY A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 SER 288 288 288 SER SER A . n A 1 289 LYS 289 289 289 LYS LYS A . n A 1 290 LYS 290 290 290 LYS LYS A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 TYR 293 293 293 TYR TYR A . n A 1 294 THR 294 294 294 THR THR A . n A 1 295 ALA 295 295 295 ALA ALA A . n A 1 296 VAL 296 296 296 VAL VAL A . n A 1 297 LEU 297 297 297 LEU LEU A . n A 1 298 ASN 298 298 298 ASN ASN A . n A 1 299 ALA 299 299 299 ALA ALA A . n A 1 300 LEU 300 300 300 LEU LEU A . n A 1 301 ASN 301 301 301 ASN ASN A . n A 1 302 GLY 302 302 ? ? ? A . n A 1 303 GLY 303 303 ? ? ? A . n A 1 304 GLY 304 304 ? ? ? A . n A 1 305 SER 305 305 ? ? ? A . n A 1 306 ARG 306 306 ? ? ? A . n A 1 307 SER 307 307 ? ? ? A . n A 1 308 HIS 308 308 ? ? ? A . n A 1 309 HIS 309 309 ? ? ? A . n A 1 310 HIS 310 310 ? ? ? A . n A 1 311 HIS 311 311 ? ? ? A . n A 1 312 HIS 312 312 ? ? ? A . n A 1 313 HIS 313 313 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 PO4 1 900 900 PO4 PO4 A . E 3 PO4 1 901 901 PO4 PO4 A . F 3 PO4 1 902 902 PO4 PO4 A . G 3 PO4 1 903 903 PO4 PO4 A . H 3 PO4 1 904 904 PO4 PO4 A . I 3 PO4 1 905 905 PO4 PO4 A . J 4 HOH 1 906 1 HOH HOH A . J 4 HOH 2 907 2 HOH HOH A . J 4 HOH 3 908 3 HOH HOH A . J 4 HOH 4 909 4 HOH HOH A . J 4 HOH 5 910 5 HOH HOH A . J 4 HOH 6 911 6 HOH HOH A . J 4 HOH 7 912 8 HOH HOH A . J 4 HOH 8 913 10 HOH HOH A . J 4 HOH 9 914 11 HOH HOH A . J 4 HOH 10 915 12 HOH HOH A . J 4 HOH 11 916 13 HOH HOH A . J 4 HOH 12 917 15 HOH HOH A . J 4 HOH 13 918 16 HOH HOH A . J 4 HOH 14 919 17 HOH HOH A . J 4 HOH 15 920 19 HOH HOH A . J 4 HOH 16 921 20 HOH HOH A . J 4 HOH 17 922 22 HOH HOH A . J 4 HOH 18 923 23 HOH HOH A . J 4 HOH 19 924 24 HOH HOH A . J 4 HOH 20 925 25 HOH HOH A . J 4 HOH 21 926 26 HOH HOH A . J 4 HOH 22 927 28 HOH HOH A . J 4 HOH 23 928 30 HOH HOH A . J 4 HOH 24 929 31 HOH HOH A . J 4 HOH 25 930 32 HOH HOH A . J 4 HOH 26 931 33 HOH HOH A . J 4 HOH 27 932 34 HOH HOH A . J 4 HOH 28 933 35 HOH HOH A . J 4 HOH 29 934 36 HOH HOH A . J 4 HOH 30 935 37 HOH HOH A . J 4 HOH 31 936 38 HOH HOH A . J 4 HOH 32 937 39 HOH HOH A . J 4 HOH 33 938 40 HOH HOH A . J 4 HOH 34 939 41 HOH HOH A . J 4 HOH 35 940 43 HOH HOH A . J 4 HOH 36 941 46 HOH HOH A . J 4 HOH 37 942 47 HOH HOH A . J 4 HOH 38 943 48 HOH HOH A . J 4 HOH 39 944 51 HOH HOH A . J 4 HOH 40 945 52 HOH HOH A . J 4 HOH 41 946 53 HOH HOH A . J 4 HOH 42 947 54 HOH HOH A . J 4 HOH 43 948 55 HOH HOH A . J 4 HOH 44 949 56 HOH HOH A . J 4 HOH 45 950 57 HOH HOH A . J 4 HOH 46 951 58 HOH HOH A . J 4 HOH 47 952 59 HOH HOH A . J 4 HOH 48 953 60 HOH HOH A . J 4 HOH 49 954 62 HOH HOH A . J 4 HOH 50 955 63 HOH HOH A . J 4 HOH 51 956 64 HOH HOH A . J 4 HOH 52 957 65 HOH HOH A . J 4 HOH 53 958 66 HOH HOH A . J 4 HOH 54 959 67 HOH HOH A . J 4 HOH 55 960 68 HOH HOH A . J 4 HOH 56 961 69 HOH HOH A . J 4 HOH 57 962 70 HOH HOH A . J 4 HOH 58 963 71 HOH HOH A . J 4 HOH 59 964 72 HOH HOH A . J 4 HOH 60 965 73 HOH HOH A . J 4 HOH 61 966 74 HOH HOH A . J 4 HOH 62 967 75 HOH HOH A . J 4 HOH 63 968 76 HOH HOH A . J 4 HOH 64 969 77 HOH HOH A . J 4 HOH 65 970 78 HOH HOH A . J 4 HOH 66 971 79 HOH HOH A . J 4 HOH 67 972 80 HOH HOH A . J 4 HOH 68 973 81 HOH HOH A . J 4 HOH 69 974 82 HOH HOH A . J 4 HOH 70 975 83 HOH HOH A . J 4 HOH 71 976 84 HOH HOH A . J 4 HOH 72 977 85 HOH HOH A . J 4 HOH 73 978 86 HOH HOH A . J 4 HOH 74 979 87 HOH HOH A . J 4 HOH 75 980 88 HOH HOH A . J 4 HOH 76 981 89 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 943 ? J HOH . 2 1 A HOH 944 ? J HOH . 3 1 A HOH 951 ? J HOH . 4 1 A HOH 962 ? J HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-03-06 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-02-29 5 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 5 'Structure model' Advisory 5 5 'Structure model' 'Atomic model' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' atom_site 2 5 'Structure model' chem_comp 3 5 'Structure model' database_PDB_caveat 4 5 'Structure model' entity 5 5 'Structure model' pdbx_branch_scheme 6 5 'Structure model' pdbx_chem_comp_identifier 7 5 'Structure model' pdbx_entity_branch 8 5 'Structure model' pdbx_entity_branch_descriptor 9 5 'Structure model' pdbx_entity_branch_link 10 5 'Structure model' pdbx_entity_branch_list 11 5 'Structure model' pdbx_entity_nonpoly 12 5 'Structure model' pdbx_nonpoly_scheme 13 5 'Structure model' pdbx_struct_assembly_gen 14 5 'Structure model' pdbx_struct_special_symmetry 15 5 'Structure model' pdbx_validate_chiral 16 5 'Structure model' struct_asym 17 5 'Structure model' struct_conn 18 5 'Structure model' struct_ref_seq_dif 19 5 'Structure model' struct_site 20 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_atom_site.B_iso_or_equiv' 2 5 'Structure model' '_atom_site.Cartn_x' 3 5 'Structure model' '_atom_site.Cartn_y' 4 5 'Structure model' '_atom_site.Cartn_z' 5 5 'Structure model' '_atom_site.auth_asym_id' 6 5 'Structure model' '_atom_site.auth_atom_id' 7 5 'Structure model' '_atom_site.auth_seq_id' 8 5 'Structure model' '_atom_site.label_asym_id' 9 5 'Structure model' '_atom_site.label_atom_id' 10 5 'Structure model' '_atom_site.type_symbol' 11 5 'Structure model' '_chem_comp.name' 12 5 'Structure model' '_chem_comp.type' 13 5 'Structure model' '_entity.formula_weight' 14 5 'Structure model' '_entity.pdbx_description' 15 5 'Structure model' '_entity.pdbx_number_of_molecules' 16 5 'Structure model' '_entity.type' 17 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 5 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 19 5 'Structure model' '_pdbx_validate_chiral.auth_asym_id' 20 5 'Structure model' '_pdbx_validate_chiral.auth_seq_id' 21 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 22 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 23 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 26 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran ? 1 PDB_EXTRACT 1.701 'OCT. 28, 2005' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 MOSFLM . ? ? ? ? 'data reduction' ? ? ? 3 CCP4 '(SCALA)' ? ? ? ? 'data scaling' ? ? ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 906 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 953 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 132 ? ? CG A ASP 132 ? ? OD2 A ASP 132 ? ? 124.35 118.30 6.05 0.90 N 2 1 CB A ASP 191 ? ? CG A ASP 191 ? ? OD2 A ASP 191 ? ? 124.08 118.30 5.78 0.90 N 3 1 CB A ASP 253 ? ? CG A ASP 253 ? ? OD2 A ASP 253 ? ? 123.84 118.30 5.54 0.90 N 4 1 CB A ASP 278 ? ? CG A ASP 278 ? ? OD2 A ASP 278 ? ? 123.75 118.30 5.45 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? 133.34 -49.59 2 1 ASN A 45 ? ? -140.76 -23.05 3 1 ASP A 140 ? ? -105.50 40.22 4 1 ASP A 149 ? ? -68.10 2.78 5 1 ASP A 162 ? ? -161.22 84.95 6 1 ASN A 209 ? ? -168.30 -167.96 7 1 THR A 279 ? ? 31.16 60.21 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ALA _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 1 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 2 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -47.35 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 C1 ? B XYS 1 ? 'WRONG HAND' . 2 1 C1 ? B XYS 2 ? 'WRONG HAND' . 3 1 C1 ? C XYS 1 ? 'WRONG HAND' . 4 1 C1 ? C XYS 2 ? 'WRONG HAND' . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 302 ? A GLY 302 2 1 Y 1 A GLY 303 ? A GLY 303 3 1 Y 1 A GLY 304 ? A GLY 304 4 1 Y 1 A SER 305 ? A SER 305 5 1 Y 1 A ARG 306 ? A ARG 306 6 1 Y 1 A SER 307 ? A SER 307 7 1 Y 1 A HIS 308 ? A HIS 308 8 1 Y 1 A HIS 309 ? A HIS 309 9 1 Y 1 A HIS 310 ? A HIS 310 10 1 Y 1 A HIS 311 ? A HIS 311 11 1 Y 1 A HIS 312 ? A HIS 312 12 1 Y 1 A HIS 313 ? A HIS 313 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 XYS 1 B XYS 1 ? XYS 701 n B 2 XYS 2 B XYS 2 ? XYS 700 n C 2 XYS 1 C XYS 1 ? XYS 801 n C 2 XYS 2 C XYS 2 ? XYS 800 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier XYS 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DXylpa XYS 'COMMON NAME' GMML 1.0 a-D-xylopyranose XYS 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Xylp XYS 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Xyl # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DXylpa1-4DXylpa1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a212h-1a_1-5]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Xylp]{[(4+1)][b-D-Xylp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 XYS _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 XYS _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 XYS 1 n 2 XYS 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'PHOSPHATE ION' PO4 4 water HOH #