data_2H3F # _entry.id 2H3F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2H3F pdb_00002h3f 10.2210/pdb2h3f/pdb RCSB RCSB037880 ? ? WWPDB D_1000037880 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2H3F _pdbx_database_status.recvd_initial_deposition_date 2006-05-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Saad, J.S.' 1 'Miller, J.' 2 'Tai, J.' 3 'Kim, A.' 4 'Ghanam, R.H.' 5 'Summers, M.F.' 6 # _citation.id primary _citation.title 'Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 103 _citation.page_first 11364 _citation.page_last 11369 _citation.year 2006 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16840558 _citation.pdbx_database_id_DOI 10.1073/pnas.0602818103 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Saad, J.S.' 1 ? primary 'Miller, J.' 2 ? primary 'Tai, J.' 3 ? primary 'Kim, A.' 4 ? primary 'Ghanam, R.H.' 5 ? primary 'Summers, M.F.' 6 ? # _cell.entry_id 2H3F _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2H3F _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Gag polyprotein' _entity.formula_weight 14734.616 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 2-132' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNT IAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY ; _entity_poly.pdbx_seq_one_letter_code_can ;GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNT IAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 ARG n 1 4 ALA n 1 5 SER n 1 6 VAL n 1 7 LEU n 1 8 SER n 1 9 GLY n 1 10 GLY n 1 11 GLU n 1 12 LEU n 1 13 ASP n 1 14 LYS n 1 15 TRP n 1 16 GLU n 1 17 LYS n 1 18 ILE n 1 19 ARG n 1 20 LEU n 1 21 ARG n 1 22 PRO n 1 23 GLY n 1 24 GLY n 1 25 LYS n 1 26 LYS n 1 27 GLN n 1 28 TYR n 1 29 LYS n 1 30 LEU n 1 31 LYS n 1 32 HIS n 1 33 ILE n 1 34 VAL n 1 35 TRP n 1 36 ALA n 1 37 SER n 1 38 ARG n 1 39 GLU n 1 40 LEU n 1 41 GLU n 1 42 ARG n 1 43 PHE n 1 44 ALA n 1 45 VAL n 1 46 ASN n 1 47 PRO n 1 48 GLY n 1 49 LEU n 1 50 LEU n 1 51 GLU n 1 52 THR n 1 53 SER n 1 54 GLU n 1 55 GLY n 1 56 CYS n 1 57 ARG n 1 58 GLN n 1 59 ILE n 1 60 LEU n 1 61 GLY n 1 62 GLN n 1 63 LEU n 1 64 GLN n 1 65 PRO n 1 66 SER n 1 67 LEU n 1 68 GLN n 1 69 THR n 1 70 GLY n 1 71 SER n 1 72 GLU n 1 73 GLU n 1 74 LEU n 1 75 ARG n 1 76 SER n 1 77 LEU n 1 78 TYR n 1 79 ASN n 1 80 THR n 1 81 ILE n 1 82 ALA n 1 83 VAL n 1 84 LEU n 1 85 TYR n 1 86 CYS n 1 87 VAL n 1 88 HIS n 1 89 GLN n 1 90 ARG n 1 91 ILE n 1 92 ASP n 1 93 VAL n 1 94 LYS n 1 95 ASP n 1 96 THR n 1 97 LYS n 1 98 GLU n 1 99 ALA n 1 100 LEU n 1 101 ASP n 1 102 LYS n 1 103 ILE n 1 104 GLU n 1 105 GLU n 1 106 GLU n 1 107 GLN n 1 108 ASN n 1 109 LYS n 1 110 SER n 1 111 LYS n 1 112 LYS n 1 113 LYS n 1 114 ALA n 1 115 GLN n 1 116 GLN n 1 117 ALA n 1 118 ALA n 1 119 ALA n 1 120 ASP n 1 121 THR n 1 122 GLY n 1 123 ASN n 1 124 ASN n 1 125 SER n 1 126 GLN n 1 127 VAL n 1 128 SER n 1 129 GLN n 1 130 ASN n 1 131 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1N5 _struct_ref.pdbx_db_accession P12497 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2H3F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12497 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50mM phosphate buffer, 5mM DTT, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 600 ? 2 DRX Bruker 800 ? # _pdbx_nmr_ensemble.entry_id 2H3F _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2H3F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CYANA _pdbx_nmr_software.version ? _pdbx_nmr_software.authors 'P.GUNTERT ET AL.' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 2H3F _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2H3F _struct.title 'Solution structure of the HIV-1 MA protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2H3F _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'HIV-1 unmyristoylated MA protein, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 8 ? GLU A 16 ? SER A 9 GLU A 17 1 ? 9 HELX_P HELX_P2 2 LYS A 29 ? GLU A 41 ? LYS A 30 GLU A 42 1 ? 13 HELX_P HELX_P3 3 ARG A 42 ? ALA A 44 ? ARG A 43 ALA A 45 5 ? 3 HELX_P HELX_P4 4 THR A 52 ? GLN A 64 ? THR A 53 GLN A 65 1 ? 13 HELX_P HELX_P5 5 PRO A 65 ? GLY A 70 ? PRO A 66 GLY A 71 5 ? 6 HELX_P HELX_P6 6 SER A 71 ? GLN A 89 ? SER A 72 GLN A 90 1 ? 19 HELX_P HELX_P7 7 ASP A 95 ? LYS A 112 ? ASP A 96 LYS A 113 1 ? 18 HELX_P HELX_P8 8 LYS A 113 ? GLN A 115 ? LYS A 114 GLN A 116 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2H3F _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2H3F _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2 2 GLY GLY A . n A 1 2 ALA 2 3 3 ALA ALA A . n A 1 3 ARG 3 4 4 ARG ARG A . n A 1 4 ALA 4 5 5 ALA ALA A . n A 1 5 SER 5 6 6 SER SER A . n A 1 6 VAL 6 7 7 VAL VAL A . n A 1 7 LEU 7 8 8 LEU LEU A . n A 1 8 SER 8 9 9 SER SER A . n A 1 9 GLY 9 10 10 GLY GLY A . n A 1 10 GLY 10 11 11 GLY GLY A . n A 1 11 GLU 11 12 12 GLU GLU A . n A 1 12 LEU 12 13 13 LEU LEU A . n A 1 13 ASP 13 14 14 ASP ASP A . n A 1 14 LYS 14 15 15 LYS LYS A . n A 1 15 TRP 15 16 16 TRP TRP A . n A 1 16 GLU 16 17 17 GLU GLU A . n A 1 17 LYS 17 18 18 LYS LYS A . n A 1 18 ILE 18 19 19 ILE ILE A . n A 1 19 ARG 19 20 20 ARG ARG A . n A 1 20 LEU 20 21 21 LEU LEU A . n A 1 21 ARG 21 22 22 ARG ARG A . n A 1 22 PRO 22 23 23 PRO PRO A . n A 1 23 GLY 23 24 24 GLY GLY A . n A 1 24 GLY 24 25 25 GLY GLY A . n A 1 25 LYS 25 26 26 LYS LYS A . n A 1 26 LYS 26 27 27 LYS LYS A . n A 1 27 GLN 27 28 28 GLN GLN A . n A 1 28 TYR 28 29 29 TYR TYR A . n A 1 29 LYS 29 30 30 LYS LYS A . n A 1 30 LEU 30 31 31 LEU LEU A . n A 1 31 LYS 31 32 32 LYS LYS A . n A 1 32 HIS 32 33 33 HIS HIS A . n A 1 33 ILE 33 34 34 ILE ILE A . n A 1 34 VAL 34 35 35 VAL VAL A . n A 1 35 TRP 35 36 36 TRP TRP A . n A 1 36 ALA 36 37 37 ALA ALA A . n A 1 37 SER 37 38 38 SER SER A . n A 1 38 ARG 38 39 39 ARG ARG A . n A 1 39 GLU 39 40 40 GLU GLU A . n A 1 40 LEU 40 41 41 LEU LEU A . n A 1 41 GLU 41 42 42 GLU GLU A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 PHE 43 44 44 PHE PHE A . n A 1 44 ALA 44 45 45 ALA ALA A . n A 1 45 VAL 45 46 46 VAL VAL A . n A 1 46 ASN 46 47 47 ASN ASN A . n A 1 47 PRO 47 48 48 PRO PRO A . n A 1 48 GLY 48 49 49 GLY GLY A . n A 1 49 LEU 49 50 50 LEU LEU A . n A 1 50 LEU 50 51 51 LEU LEU A . n A 1 51 GLU 51 52 52 GLU GLU A . n A 1 52 THR 52 53 53 THR THR A . n A 1 53 SER 53 54 54 SER SER A . n A 1 54 GLU 54 55 55 GLU GLU A . n A 1 55 GLY 55 56 56 GLY GLY A . n A 1 56 CYS 56 57 57 CYS CYS A . n A 1 57 ARG 57 58 58 ARG ARG A . n A 1 58 GLN 58 59 59 GLN GLN A . n A 1 59 ILE 59 60 60 ILE ILE A . n A 1 60 LEU 60 61 61 LEU LEU A . n A 1 61 GLY 61 62 62 GLY GLY A . n A 1 62 GLN 62 63 63 GLN GLN A . n A 1 63 LEU 63 64 64 LEU LEU A . n A 1 64 GLN 64 65 65 GLN GLN A . n A 1 65 PRO 65 66 66 PRO PRO A . n A 1 66 SER 66 67 67 SER SER A . n A 1 67 LEU 67 68 68 LEU LEU A . n A 1 68 GLN 68 69 69 GLN GLN A . n A 1 69 THR 69 70 70 THR THR A . n A 1 70 GLY 70 71 71 GLY GLY A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 GLU 72 73 73 GLU GLU A . n A 1 73 GLU 73 74 74 GLU GLU A . n A 1 74 LEU 74 75 75 LEU LEU A . n A 1 75 ARG 75 76 76 ARG ARG A . n A 1 76 SER 76 77 77 SER SER A . n A 1 77 LEU 77 78 78 LEU LEU A . n A 1 78 TYR 78 79 79 TYR TYR A . n A 1 79 ASN 79 80 80 ASN ASN A . n A 1 80 THR 80 81 81 THR THR A . n A 1 81 ILE 81 82 82 ILE ILE A . n A 1 82 ALA 82 83 83 ALA ALA A . n A 1 83 VAL 83 84 84 VAL VAL A . n A 1 84 LEU 84 85 85 LEU LEU A . n A 1 85 TYR 85 86 86 TYR TYR A . n A 1 86 CYS 86 87 87 CYS CYS A . n A 1 87 VAL 87 88 88 VAL VAL A . n A 1 88 HIS 88 89 89 HIS HIS A . n A 1 89 GLN 89 90 90 GLN GLN A . n A 1 90 ARG 90 91 91 ARG ARG A . n A 1 91 ILE 91 92 92 ILE ILE A . n A 1 92 ASP 92 93 93 ASP ASP A . n A 1 93 VAL 93 94 94 VAL VAL A . n A 1 94 LYS 94 95 95 LYS LYS A . n A 1 95 ASP 95 96 96 ASP ASP A . n A 1 96 THR 96 97 97 THR THR A . n A 1 97 LYS 97 98 98 LYS LYS A . n A 1 98 GLU 98 99 99 GLU GLU A . n A 1 99 ALA 99 100 100 ALA ALA A . n A 1 100 LEU 100 101 101 LEU LEU A . n A 1 101 ASP 101 102 102 ASP ASP A . n A 1 102 LYS 102 103 103 LYS LYS A . n A 1 103 ILE 103 104 104 ILE ILE A . n A 1 104 GLU 104 105 105 GLU GLU A . n A 1 105 GLU 105 106 106 GLU GLU A . n A 1 106 GLU 106 107 107 GLU GLU A . n A 1 107 GLN 107 108 108 GLN GLN A . n A 1 108 ASN 108 109 109 ASN ASN A . n A 1 109 LYS 109 110 110 LYS LYS A . n A 1 110 SER 110 111 111 SER SER A . n A 1 111 LYS 111 112 112 LYS LYS A . n A 1 112 LYS 112 113 113 LYS LYS A . n A 1 113 LYS 113 114 114 LYS LYS A . n A 1 114 ALA 114 115 115 ALA ALA A . n A 1 115 GLN 115 116 116 GLN GLN A . n A 1 116 GLN 116 117 117 GLN GLN A . n A 1 117 ALA 117 118 118 ALA ALA A . n A 1 118 ALA 118 119 119 ALA ALA A . n A 1 119 ALA 119 120 120 ALA ALA A . n A 1 120 ASP 120 121 121 ASP ASP A . n A 1 121 THR 121 122 122 THR THR A . n A 1 122 GLY 122 123 123 GLY GLY A . n A 1 123 ASN 123 124 124 ASN ASN A . n A 1 124 ASN 124 125 125 ASN ASN A . n A 1 125 SER 125 126 126 SER SER A . n A 1 126 GLN 126 127 127 GLN GLN A . n A 1 127 VAL 127 128 128 VAL VAL A . n A 1 128 SER 128 129 129 SER SER A . n A 1 129 GLN 129 130 130 GLN GLN A . n A 1 130 ASN 130 131 131 ASN ASN A . n A 1 131 TYR 131 132 132 TYR TYR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-07-25 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 3 ? ? -159.14 45.88 2 1 ALA A 5 ? ? -178.30 126.81 3 1 SER A 6 ? ? -47.52 154.19 4 1 SER A 72 ? ? -55.35 176.85 5 1 GLN A 130 ? ? -166.51 40.51 6 2 SER A 6 ? ? -170.21 136.86 7 2 VAL A 7 ? ? -134.29 -66.93 8 2 GLU A 52 ? ? -99.20 32.10 9 2 THR A 53 ? ? -168.96 112.91 10 2 SER A 72 ? ? -53.32 171.63 11 2 ASP A 96 ? ? 179.60 178.89 12 2 LYS A 114 ? ? -98.76 31.95 13 2 ALA A 115 ? ? -161.61 31.81 14 2 ALA A 120 ? ? -149.70 -58.82 15 2 THR A 122 ? ? 51.41 -170.81 16 3 ASP A 96 ? ? 179.46 179.61 17 3 ALA A 119 ? ? -98.18 55.36 18 3 ALA A 120 ? ? -158.22 31.07 19 3 GLN A 130 ? ? -173.66 124.96 20 4 LYS A 18 ? ? -71.60 -70.50 21 4 SER A 72 ? ? -57.00 179.67 22 4 SER A 111 ? ? -96.97 33.12 23 4 SER A 126 ? ? -152.03 39.37 24 5 ALA A 5 ? ? -175.57 41.03 25 5 SER A 6 ? ? -45.53 156.94 26 5 LYS A 18 ? ? -72.30 -72.64 27 5 GLU A 52 ? ? -96.54 31.16 28 5 SER A 72 ? ? -58.94 170.98 29 5 ASP A 96 ? ? 177.51 -178.97 30 5 ALA A 119 ? ? -102.03 61.72 31 5 ALA A 120 ? ? -159.48 26.85 32 5 ASP A 121 ? ? -112.95 50.80 33 5 GLN A 127 ? ? -173.01 34.82 34 6 VAL A 7 ? ? -102.27 -63.93 35 6 SER A 72 ? ? -55.81 177.42 36 6 ASP A 96 ? ? 179.24 -179.91 37 6 ALA A 119 ? ? -146.56 -46.05 38 7 ILE A 19 ? ? -36.12 134.73 39 7 LYS A 27 ? ? -26.85 122.15 40 7 GLU A 52 ? ? -96.85 32.96 41 7 THR A 53 ? ? -166.68 111.76 42 7 SER A 72 ? ? -56.09 173.69 43 7 ASP A 96 ? ? 178.82 -179.12 44 7 ALA A 119 ? ? -100.79 -168.14 45 7 ASN A 125 ? ? -173.77 49.37 46 7 SER A 126 ? ? -164.96 119.74 47 7 ASN A 131 ? ? -127.14 -67.66 48 8 SER A 6 ? ? -159.83 -74.54 49 8 LYS A 18 ? ? -71.23 -70.44 50 8 SER A 72 ? ? -59.32 -173.87 51 8 ARG A 91 ? ? 80.58 2.04 52 8 VAL A 94 ? ? -38.42 147.25 53 8 LYS A 114 ? ? -99.08 33.13 54 8 ALA A 115 ? ? -148.42 26.70 55 8 ALA A 119 ? ? -134.36 -60.26 56 8 SER A 126 ? ? -119.72 -73.26 57 8 SER A 129 ? ? -148.30 51.85 58 9 VAL A 7 ? ? -127.00 -67.46 59 9 ILE A 19 ? ? -39.52 142.89 60 9 GLU A 52 ? ? -98.36 32.37 61 9 THR A 53 ? ? -164.58 110.20 62 9 SER A 72 ? ? -53.34 170.51 63 9 GLN A 90 ? ? -89.06 31.24 64 9 GLN A 116 ? ? -168.04 33.02 65 9 ALA A 119 ? ? -92.05 50.52 66 9 ALA A 120 ? ? -140.02 -82.47 67 10 ALA A 5 ? ? -95.39 42.03 68 10 LYS A 18 ? ? -71.74 -71.09 69 10 SER A 72 ? ? -59.23 173.83 70 10 ASP A 96 ? ? 179.37 177.70 71 10 ALA A 120 ? ? -159.17 54.68 72 10 ASP A 121 ? ? -164.16 34.65 73 10 SER A 129 ? ? -163.41 118.06 74 11 SER A 6 ? ? -167.90 84.91 75 11 LYS A 18 ? ? -71.49 -70.81 76 11 ASP A 96 ? ? 176.64 -177.83 77 11 ASN A 125 ? ? -151.68 50.33 78 12 ALA A 3 ? ? -105.91 -65.62 79 12 SER A 6 ? ? -177.61 101.92 80 12 VAL A 7 ? ? -101.83 -60.68 81 12 LYS A 18 ? ? -72.02 -71.45 82 12 GLN A 90 ? ? -91.48 31.24 83 12 ALA A 120 ? ? -159.75 -59.61 84 13 ALA A 3 ? ? -175.35 121.11 85 13 LYS A 18 ? ? -71.19 -70.09 86 13 GLN A 90 ? ? -91.87 31.01 87 13 LYS A 114 ? ? -96.36 32.50 88 13 ALA A 115 ? ? -151.65 34.76 89 13 ALA A 120 ? ? -165.23 -40.40 90 13 VAL A 128 ? ? -143.25 37.51 91 13 ASN A 131 ? ? -150.68 81.10 92 14 LYS A 18 ? ? -71.79 -70.82 93 14 ASP A 96 ? ? 176.98 -178.80 94 14 ALA A 115 ? ? -170.65 39.73 95 14 ALA A 119 ? ? -105.38 55.22 96 14 ALA A 120 ? ? -174.35 33.77 97 15 ALA A 3 ? ? -141.79 -41.78 98 15 ARG A 4 ? ? 63.61 82.63 99 15 LYS A 18 ? ? -71.42 -71.22 100 15 GLN A 90 ? ? -91.49 30.84 101 15 LYS A 114 ? ? -152.79 33.11 102 15 ALA A 119 ? ? -150.82 35.06 103 15 ASN A 124 ? ? -169.94 79.17 104 15 ASN A 131 ? ? -145.08 47.75 105 16 VAL A 7 ? ? -125.08 -53.48 106 16 LYS A 18 ? ? -71.56 -70.49 107 16 SER A 72 ? ? -57.45 -177.15 108 16 VAL A 94 ? ? -39.22 150.24 109 16 ALA A 120 ? ? -168.71 40.41 110 16 ASN A 125 ? ? 63.13 90.26 111 16 GLN A 127 ? ? -56.97 108.94 112 16 SER A 129 ? ? -66.90 -173.88 113 16 ASN A 131 ? ? -178.87 107.22 114 17 ALA A 3 ? ? -121.09 -61.83 115 17 SER A 6 ? ? 179.88 91.69 116 17 LYS A 18 ? ? -70.99 -70.69 117 17 SER A 72 ? ? -53.32 172.38 118 17 ASP A 96 ? ? 174.72 -175.66 119 17 ALA A 118 ? ? -174.34 -40.69 120 17 ASN A 125 ? ? -173.35 138.07 121 18 SER A 6 ? ? 63.58 178.04 122 18 LYS A 18 ? ? -71.42 -71.38 123 18 SER A 72 ? ? -59.41 176.32 124 18 ARG A 91 ? ? 80.40 4.29 125 18 VAL A 94 ? ? -36.44 143.97 126 18 LYS A 114 ? ? -96.51 32.44 127 18 ALA A 115 ? ? -145.47 26.86 128 18 GLN A 116 ? ? -169.71 61.08 129 18 ALA A 119 ? ? -150.72 32.32 130 18 ALA A 120 ? ? -155.21 33.64 131 19 LYS A 18 ? ? -71.90 -73.46 132 19 ILE A 19 ? ? -39.80 146.10 133 19 SER A 72 ? ? -58.90 171.73 134 19 ASP A 96 ? ? 176.92 -177.38 135 19 ASP A 121 ? ? 69.30 -75.83 136 19 THR A 122 ? ? 51.34 -170.89 137 19 SER A 126 ? ? -171.56 138.72 138 20 LYS A 18 ? ? -71.50 -70.45 139 20 SER A 72 ? ? -57.64 170.79 140 20 ASP A 96 ? ? 178.17 179.29 141 20 GLN A 116 ? ? -164.18 30.28 142 20 ASP A 121 ? ? 69.31 -75.89 143 20 THR A 122 ? ? 64.32 163.53 144 20 SER A 126 ? ? -65.35 -175.20 #