data_2I7O # _entry.id 2I7O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2I7O pdb_00002i7o 10.2210/pdb2i7o/pdb RCSB RCSB039240 ? ? WWPDB D_1000039240 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1BEX _pdbx_database_related.details 'Structure of ruthenium-modified Pseudomonas aeruginosa azurin' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2I7O _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-08-31 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sudhamsu, J.' 1 'Crane, B.R.' 2 # _citation.id primary _citation.title 'Tryptophan-accelerated electron flow through proteins.' _citation.journal_abbrev Science _citation.journal_volume 320 _citation.page_first 1760 _citation.page_last 1762 _citation.year 2008 _citation.journal_id_ASTM SCIEAS _citation.country US _citation.journal_id_ISSN 0036-8075 _citation.journal_id_CSD 0038 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18583608 _citation.pdbx_database_id_DOI 10.1126/science.1158241 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shih, C.' 1 ? primary 'Museth, A.K.' 2 ? primary 'Abrahamsson, M.' 3 ? primary 'Blanco-Rodriguez, A.M.' 4 ? primary 'Di Bilio, A.J.' 5 ? primary 'Sudhamsu, J.' 6 ? primary 'Crane, B.R.' 7 ? primary 'Ronayne, K.L.' 8 ? primary 'Towrie, M.' 9 ? primary 'Vlcek, A.' 10 ? primary 'Richards, J.H.' 11 ? primary 'Winkler, J.R.' 12 ? primary 'Gray, H.B.' 13 ? # _cell.length_a 63.223 _cell.length_b 69.075 _cell.length_c 68.944 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 2I7O _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.entry_id 2I7O _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 23 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Azurin 14044.868 1 ? 'H83N, K122W, T124H' ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn '(1,10 PHENANTHROLINE)-(TRI-CARBON MONOXIDE) RHENIUM (I)' 478.496 1 ? ? ? ? 4 water nat water 18.015 65 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMWGHLTLK ; _entity_poly.pdbx_seq_one_letter_code_can ;AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMWGHLTLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 CYS n 1 4 SER n 1 5 VAL n 1 6 ASP n 1 7 ILE n 1 8 GLN n 1 9 GLY n 1 10 ASN n 1 11 ASP n 1 12 GLN n 1 13 MET n 1 14 GLN n 1 15 PHE n 1 16 ASN n 1 17 THR n 1 18 ASN n 1 19 ALA n 1 20 ILE n 1 21 THR n 1 22 VAL n 1 23 ASP n 1 24 LYS n 1 25 SER n 1 26 CYS n 1 27 LYS n 1 28 GLN n 1 29 PHE n 1 30 THR n 1 31 VAL n 1 32 ASN n 1 33 LEU n 1 34 SER n 1 35 HIS n 1 36 PRO n 1 37 GLY n 1 38 ASN n 1 39 LEU n 1 40 PRO n 1 41 LYS n 1 42 ASN n 1 43 VAL n 1 44 MET n 1 45 GLY n 1 46 HIS n 1 47 ASN n 1 48 TRP n 1 49 VAL n 1 50 LEU n 1 51 SER n 1 52 THR n 1 53 ALA n 1 54 ALA n 1 55 ASP n 1 56 MET n 1 57 GLN n 1 58 GLY n 1 59 VAL n 1 60 VAL n 1 61 THR n 1 62 ASP n 1 63 GLY n 1 64 MET n 1 65 ALA n 1 66 SER n 1 67 GLY n 1 68 LEU n 1 69 ASP n 1 70 LYS n 1 71 ASP n 1 72 TYR n 1 73 LEU n 1 74 LYS n 1 75 PRO n 1 76 ASP n 1 77 ASP n 1 78 SER n 1 79 ARG n 1 80 VAL n 1 81 ILE n 1 82 ALA n 1 83 GLN n 1 84 THR n 1 85 LYS n 1 86 LEU n 1 87 ILE n 1 88 GLY n 1 89 SER n 1 90 GLY n 1 91 GLU n 1 92 LYS n 1 93 ASP n 1 94 SER n 1 95 VAL n 1 96 THR n 1 97 PHE n 1 98 ASP n 1 99 VAL n 1 100 SER n 1 101 LYS n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 GLY n 1 106 GLU n 1 107 GLN n 1 108 TYR n 1 109 MET n 1 110 PHE n 1 111 PHE n 1 112 CYS n 1 113 THR n 1 114 PHE n 1 115 PRO n 1 116 GLY n 1 117 HIS n 1 118 SER n 1 119 ALA n 1 120 LEU n 1 121 MET n 1 122 TRP n 1 123 GLY n 1 124 HIS n 1 125 LEU n 1 126 THR n 1 127 LEU n 1 128 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene azu _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AZUR_PSEAE _struct_ref.pdbx_db_accession P00282 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK ; _struct_ref.pdbx_align_begin 21 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2I7O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00282 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 128 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2I7O GLN A 2 ? UNP P00282 GLU 22 conflict 2 1 1 2I7O GLN A 83 ? UNP P00282 HIS 103 'engineered mutation' 83 2 1 2I7O TRP A 122 ? UNP P00282 LYS 142 'engineered mutation' 122 3 1 2I7O HIS A 124 ? UNP P00282 THR 144 'engineered mutation' 124 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 REQ non-polymer . '(1,10 PHENANTHROLINE)-(TRI-CARBON MONOXIDE) RHENIUM (I)' ? 'C17 H12 N2 O3 Re' 478.496 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2I7O _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 54.09 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 3.2 _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '20-24% PEG 4000, 100 mM LiNO3, 100 mM citric acid, pH 3.2, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 77.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2006-05-23 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.972 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE A1' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.972 _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline A1 # _reflns.entry_id 2I7O _reflns.observed_criterion_sigma_F 2.0 _reflns.observed_criterion_sigma_I 2.0 _reflns.d_resolution_high 1.5 _reflns.d_resolution_low 50.0 _reflns.number_all 24417 _reflns.number_obs 344927 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.236 _reflns.pdbx_Rsym_value 0.082 _reflns.pdbx_netI_over_sigmaI 34.4 _reflns.B_iso_Wilson_estimate 17.2 _reflns.pdbx_redundancy 13.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 2I7O _refine.ls_d_res_high 1.500 _refine.ls_d_res_low 20.000 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 96.900 _refine.ls_number_reflns_obs 23751 _refine.ls_R_factor_R_work 0.236 _refine.ls_R_factor_R_free 0.255 _refine.ls_percent_reflns_R_free 4.600 _refine.ls_number_reflns_R_free 1134 _refine.B_iso_mean 22.961 _refine.solvent_model_param_bsol 34.250 _refine.aniso_B[1][1] 3.644 _refine.aniso_B[2][2] -7.757 _refine.aniso_B[3][3] 4.113 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 980 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 65 _refine_hist.number_atoms_total 1069 _refine_hist.d_res_high 1.500 _refine_hist.d_res_low 20.000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_mcbond_it ? 1.261 1.500 ? 'X-RAY DIFFRACTION' ? c_scbond_it ? 2.029 2.000 ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? 2.174 2.000 ? 'X-RAY DIFFRACTION' ? c_scangle_it ? 3.191 2.500 ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein.param ? 'X-RAY DIFFRACTION' 2 rephen.par ? 'X-RAY DIFFRACTION' 3 water.param ? 'X-RAY DIFFRACTION' 4 ion.param ? 'X-RAY DIFFRACTION' 5 param19x.heme ? 'X-RAY DIFFRACTION' # _struct.entry_id 2I7O _struct.title 'Structure of Re(4,7-dimethyl-phen)(Thr124His)(Lys122Trp)(His83Gln)AzCu(II), a Rhenium modified Azurin mutant' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2I7O _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'Azurin, Rhenium, Elecron Transfer, Tryptophan, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 40 ? GLY A 45 ? PRO A 40 GLY A 45 1 ? 6 HELX_P HELX_P2 2 ASP A 55 ? GLY A 67 ? ASP A 55 GLY A 67 1 ? 13 HELX_P HELX_P3 3 LEU A 68 ? ASP A 71 ? LEU A 68 ASP A 71 5 ? 4 HELX_P HELX_P4 4 SER A 100 ? LEU A 102 ? SER A 100 LEU A 102 5 ? 3 HELX_P HELX_P5 5 GLY A 116 ? LEU A 120 ? GLY A 116 LEU A 120 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 3 A CYS 26 1_555 ? ? ? ? ? ? ? 2.479 ? ? metalc1 metalc ? ? A HIS 46 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 46 A CU 901 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc2 metalc ? ? A CYS 112 SG ? ? ? 1_555 B CU . CU ? ? A CYS 112 A CU 901 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc3 metalc ? ? A HIS 117 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 117 A CU 901 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc4 metalc ? ? A HIS 124 NE2 ? ? ? 1_555 C REQ . RE ? ? A HIS 124 A REQ 801 1_555 ? ? ? ? ? ? ? 2.187 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 4 ? GLN A 8 ? SER A 4 GLN A 8 A 2 GLN A 28 ? SER A 34 ? GLN A 28 SER A 34 A 3 LYS A 92 ? ASP A 98 ? LYS A 92 ASP A 98 B 1 ALA A 19 ? ASP A 23 ? ALA A 19 ASP A 23 B 2 TRP A 122 ? LYS A 128 ? TRP A 122 LYS A 128 B 3 TYR A 108 ? PHE A 111 ? TYR A 108 PHE A 111 B 4 VAL A 49 ? THR A 52 ? VAL A 49 THR A 52 B 5 ALA A 82 ? GLN A 83 ? ALA A 82 GLN A 83 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 5 ? N VAL A 5 O ASN A 32 ? O ASN A 32 A 2 3 N LEU A 33 ? N LEU A 33 O ASP A 93 ? O ASP A 93 B 1 2 N VAL A 22 ? N VAL A 22 O LYS A 128 ? O LYS A 128 B 2 3 O LEU A 125 ? O LEU A 125 N TYR A 108 ? N TYR A 108 B 3 4 O MET A 109 ? O MET A 109 N SER A 51 ? N SER A 51 B 4 5 N LEU A 50 ? N LEU A 50 O ALA A 82 ? O ALA A 82 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CU 901 ? 5 'BINDING SITE FOR RESIDUE CU A 901' AC2 Software A REQ 801 ? 8 'BINDING SITE FOR RESIDUE REQ A 801' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLY A 45 ? GLY A 45 . ? 1_555 ? 2 AC1 5 HIS A 46 ? HIS A 46 . ? 1_555 ? 3 AC1 5 CYS A 112 ? CYS A 112 . ? 1_555 ? 4 AC1 5 HIS A 117 ? HIS A 117 . ? 1_555 ? 5 AC1 5 MET A 121 ? MET A 121 . ? 1_555 ? 6 AC2 8 ALA A 53 ? ALA A 53 . ? 4_555 ? 7 AC2 8 ALA A 53 ? ALA A 53 . ? 1_555 ? 8 AC2 8 GLN A 107 ? GLN A 107 . ? 1_555 ? 9 AC2 8 MET A 109 ? MET A 109 . ? 1_555 ? 10 AC2 8 MET A 109 ? MET A 109 . ? 4_555 ? 11 AC2 8 TRP A 122 ? TRP A 122 . ? 1_555 ? 12 AC2 8 HIS A 124 ? HIS A 124 . ? 1_555 ? 13 AC2 8 HOH D . ? HOH A 5005 . ? 4_555 ? # _atom_sites.entry_id 2I7O _atom_sites.fract_transf_matrix[1][1] 0.015817 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014477 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014505 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O RE S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 CYS 112 112 112 CYS CYS A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 TRP 122 122 122 TRP TRP A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 901 901 CU CU A . C 3 REQ 1 801 801 REQ REQ A . D 4 HOH 1 5000 5000 HOH WAT A . D 4 HOH 2 5001 5001 HOH WAT A . D 4 HOH 3 5002 5002 HOH WAT A . D 4 HOH 4 5003 5003 HOH WAT A . D 4 HOH 5 5004 5004 HOH WAT A . D 4 HOH 6 5005 5005 HOH WAT A . D 4 HOH 7 5006 5006 HOH WAT A . D 4 HOH 8 5007 5007 HOH WAT A . D 4 HOH 9 5008 5008 HOH WAT A . D 4 HOH 10 5009 5009 HOH WAT A . D 4 HOH 11 5010 5010 HOH WAT A . D 4 HOH 12 5011 5011 HOH WAT A . D 4 HOH 13 5012 5012 HOH WAT A . D 4 HOH 14 5013 5013 HOH WAT A . D 4 HOH 15 5014 5014 HOH WAT A . D 4 HOH 16 5015 5015 HOH WAT A . D 4 HOH 17 5016 5016 HOH WAT A . D 4 HOH 18 5017 5017 HOH WAT A . D 4 HOH 19 5018 5018 HOH WAT A . D 4 HOH 20 5019 5019 HOH WAT A . D 4 HOH 21 5020 5020 HOH WAT A . D 4 HOH 22 5021 5021 HOH WAT A . D 4 HOH 23 5022 5022 HOH WAT A . D 4 HOH 24 5023 5023 HOH WAT A . D 4 HOH 25 5024 5024 HOH WAT A . D 4 HOH 26 5025 5025 HOH WAT A . D 4 HOH 27 5026 5026 HOH WAT A . D 4 HOH 28 5027 5027 HOH WAT A . D 4 HOH 29 5028 5028 HOH WAT A . D 4 HOH 30 5029 5029 HOH WAT A . D 4 HOH 31 5030 5030 HOH WAT A . D 4 HOH 32 5031 5031 HOH WAT A . D 4 HOH 33 5032 5032 HOH WAT A . D 4 HOH 34 5033 5033 HOH WAT A . D 4 HOH 35 5034 5034 HOH WAT A . D 4 HOH 36 5035 5035 HOH WAT A . D 4 HOH 37 5036 5036 HOH WAT A . D 4 HOH 38 5037 5037 HOH WAT A . D 4 HOH 39 5038 5038 HOH WAT A . D 4 HOH 40 5039 5039 HOH WAT A . D 4 HOH 41 5040 5040 HOH WAT A . D 4 HOH 42 5041 5041 HOH WAT A . D 4 HOH 43 5042 5042 HOH WAT A . D 4 HOH 44 5043 5043 HOH WAT A . D 4 HOH 45 5044 5044 HOH WAT A . D 4 HOH 46 5045 5045 HOH WAT A . D 4 HOH 47 5046 5046 HOH WAT A . D 4 HOH 48 5047 5047 HOH WAT A . D 4 HOH 49 5048 5048 HOH WAT A . D 4 HOH 50 5049 5049 HOH WAT A . D 4 HOH 51 5050 5050 HOH WAT A . D 4 HOH 52 5051 5051 HOH WAT A . D 4 HOH 53 5052 5052 HOH WAT A . D 4 HOH 54 5053 5053 HOH WAT A . D 4 HOH 55 5054 5054 HOH WAT A . D 4 HOH 56 5055 5055 HOH WAT A . D 4 HOH 57 5056 5056 HOH WAT A . D 4 HOH 58 5057 5057 HOH WAT A . D 4 HOH 59 5058 5058 HOH WAT A . D 4 HOH 60 5059 5059 HOH WAT A . D 4 HOH 61 5060 5060 HOH WAT A . D 4 HOH 62 5061 5061 HOH WAT A . D 4 HOH 63 5062 5062 HOH WAT A . D 4 HOH 64 5063 5063 HOH WAT A . D 4 HOH 65 5064 5064 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU ? B CU . ? A CU 901 ? 1_555 SG ? A CYS 112 ? A CYS 112 ? 1_555 133.9 ? 2 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU ? B CU . ? A CU 901 ? 1_555 ND1 ? A HIS 117 ? A HIS 117 ? 1_555 104.7 ? 3 SG ? A CYS 112 ? A CYS 112 ? 1_555 CU ? B CU . ? A CU 901 ? 1_555 ND1 ? A HIS 117 ? A HIS 117 ? 1_555 120.6 ? 4 NE2 ? A HIS 124 ? A HIS 124 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 C3 ? C REQ . ? A REQ 801 ? 1_555 94.5 ? 5 NE2 ? A HIS 124 ? A HIS 124 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 C1 ? C REQ . ? A REQ 801 ? 1_555 179.0 ? 6 C3 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 C1 ? C REQ . ? A REQ 801 ? 1_555 86.6 ? 7 NE2 ? A HIS 124 ? A HIS 124 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 C2 ? C REQ . ? A REQ 801 ? 1_555 90.0 ? 8 C3 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 C2 ? C REQ . ? A REQ 801 ? 1_555 86.5 ? 9 C1 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 C2 ? C REQ . ? A REQ 801 ? 1_555 90.1 ? 10 NE2 ? A HIS 124 ? A HIS 124 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 N1 ? C REQ . ? A REQ 801 ? 1_555 82.6 ? 11 C3 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 N1 ? C REQ . ? A REQ 801 ? 1_555 98.7 ? 12 C1 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 N1 ? C REQ . ? A REQ 801 ? 1_555 97.2 ? 13 C2 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 N1 ? C REQ . ? A REQ 801 ? 1_555 171.2 ? 14 NE2 ? A HIS 124 ? A HIS 124 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 N2 ? C REQ . ? A REQ 801 ? 1_555 86.9 ? 15 C3 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 N2 ? C REQ . ? A REQ 801 ? 1_555 176.0 ? 16 C1 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 N2 ? C REQ . ? A REQ 801 ? 1_555 92.1 ? 17 C2 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 N2 ? C REQ . ? A REQ 801 ? 1_555 97.3 ? 18 N1 ? C REQ . ? A REQ 801 ? 1_555 RE ? C REQ . ? A REQ 801 ? 1_555 N2 ? C REQ . ? A REQ 801 ? 1_555 77.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_conn_angle 3 3 'Structure model' struct_conn 4 3 'Structure model' struct_ref_seq_dif 5 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.value' 14 3 'Structure model' '_struct_conn.pdbx_dist_value' 15 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 20 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 21 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 22 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 23 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 24 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 25 3 'Structure model' '_struct_ref_seq_dif.details' 26 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 27 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 28 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 1 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 3 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 4 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 5 AMoRE . ? ? ? ? phasing ? ? ? 6 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 5062 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 5062 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_655 _pdbx_validate_symm_contact.dist 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 44 ? ? -144.83 52.47 2 1 PRO A 115 ? ? -39.31 114.99 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 '(1,10 PHENANTHROLINE)-(TRI-CARBON MONOXIDE) RHENIUM (I)' REQ 4 water HOH #