data_2JMS # _entry.id 2JMS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JMS pdb_00002jms 10.2210/pdb2jms/pdb RCSB RCSB100028 ? ? WWPDB D_1000100028 ? ? BMRB 15058 ? 10.13018/BMR15058 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2023-12-20 6 'Structure model' 1 5 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' Other 7 4 'Structure model' 'Database references' 8 4 'Structure model' Other 9 5 'Structure model' 'Data collection' 10 5 'Structure model' Other 11 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_sample_details 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' pdbx_struct_assembly 7 3 'Structure model' pdbx_struct_oper_list 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_database_status 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 5 'Structure model' pdbx_database_status 13 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 5 'Structure model' '_pdbx_database_status.deposit_site' 9 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JMS _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-11-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15058 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pedrini, B.' 1 'Placzek, W.J.' 2 'Koculi, E.' 3 'Alimenti, C.' 4 'LaTerza, A.' 5 'Luporini, P.' 6 'Wuthrich, K.' 7 # _citation.id primary _citation.title ;Cold-adaptation in Sea-water-borne Signal Proteins: Sequence and NMR Structure of the Pheromone En-6 from the Antarctic Ciliate Euplotes nobilii ; _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 372 _citation.page_first 277 _citation.page_last 286 _citation.year 2007 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17663000 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2007.06.046 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pedrini, B.' 1 ? primary 'Placzek, W.J.' 2 ? primary 'Koculi, E.' 3 ? primary 'Alimenti, C.' 4 ? primary 'LaTerza, A.' 5 ? primary 'Luporini, P.' 6 ? primary 'Wuthrich, K.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Pheromone En-6' _entity.formula_weight 7033.396 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 32-94' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TDPEEHFDPNTNCDYTNSQDAWDYCTNYIVNSSCGEICCNDCFDETGTGACRAQAFGNSCLNW _entity_poly.pdbx_seq_one_letter_code_can TDPEEHFDPNTNCDYTNSQDAWDYCTNYIVNSSCGEICCNDCFDETGTGACRAQAFGNSCLNW _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ASP n 1 3 PRO n 1 4 GLU n 1 5 GLU n 1 6 HIS n 1 7 PHE n 1 8 ASP n 1 9 PRO n 1 10 ASN n 1 11 THR n 1 12 ASN n 1 13 CYS n 1 14 ASP n 1 15 TYR n 1 16 THR n 1 17 ASN n 1 18 SER n 1 19 GLN n 1 20 ASP n 1 21 ALA n 1 22 TRP n 1 23 ASP n 1 24 TYR n 1 25 CYS n 1 26 THR n 1 27 ASN n 1 28 TYR n 1 29 ILE n 1 30 VAL n 1 31 ASN n 1 32 SER n 1 33 SER n 1 34 CYS n 1 35 GLY n 1 36 GLU n 1 37 ILE n 1 38 CYS n 1 39 CYS n 1 40 ASN n 1 41 ASP n 1 42 CYS n 1 43 PHE n 1 44 ASP n 1 45 GLU n 1 46 THR n 1 47 GLY n 1 48 THR n 1 49 GLY n 1 50 ALA n 1 51 CYS n 1 52 ARG n 1 53 ALA n 1 54 GLN n 1 55 ALA n 1 56 PHE n 1 57 GLY n 1 58 ASN n 1 59 SER n 1 60 CYS n 1 61 LEU n 1 62 ASN n 1 63 TRP n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Euplotes nobilii' _entity_src_nat.pdbx_ncbi_taxonomy_id 184062 _entity_src_nat.genus Euplotes _entity_src_nat.species ? _entity_src_nat.strain AC-4 _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 TRP 63 63 63 TRP TRP A . n # _cell.entry_id 2JMS _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JMS _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JMS _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2JMS _struct.title 'NMR Structure of En-6 pheromone from the Antarctic Ciliate Euplotes nobilii' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JMS _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'PROTEIN, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0FKY4_EUPNO _struct_ref.pdbx_db_accession A0FKY4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TDPEEHFDPNTNCDYTNSQDAWDYCTNYIVNSSCGEICCNDCFDETGTGACRAQAFGNSCLNW _struct_ref.pdbx_align_begin 32 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JMS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0FKY4 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 63 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? HIS A 6 ? ASP A 2 HIS A 6 5 ? 5 HELX_P HELX_P2 2 ASN A 17 ? THR A 26 ? ASN A 17 THR A 26 1 ? 10 HELX_P HELX_P3 3 GLY A 35 ? PHE A 43 ? GLY A 35 PHE A 43 1 ? 9 HELX_P HELX_P4 4 ASP A 44 ? GLY A 57 ? ASP A 44 GLY A 57 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 5 CB A TYR 15 ? ? CG A TYR 15 ? ? CD2 A TYR 15 ? ? 117.25 121.00 -3.75 0.60 N 2 7 CA A CYS 25 ? ? CB A CYS 25 ? ? SG A CYS 25 ? ? 120.86 114.20 6.66 1.10 N 3 12 CB A TYR 15 ? ? CG A TYR 15 ? ? CD2 A TYR 15 ? ? 117.07 121.00 -3.93 0.60 N 4 20 CB A CYS 34 ? ? CA A CYS 34 ? ? C A CYS 34 ? ? 119.01 111.50 7.51 1.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 8 ? ? -157.77 81.33 2 1 THR A 11 ? ? -68.14 28.64 3 1 ASP A 14 ? ? -138.87 -59.96 4 1 ASN A 27 ? ? 58.37 16.11 5 1 ASN A 31 ? ? -150.66 -5.04 6 1 CYS A 34 ? ? -65.84 -174.17 7 1 ASN A 58 ? ? -144.73 -58.93 8 1 SER A 59 ? ? -123.83 -62.85 9 2 ASP A 2 ? ? 58.63 172.46 10 2 ASP A 14 ? ? -143.82 -47.96 11 2 ASN A 31 ? ? -151.44 2.83 12 2 PHE A 56 ? ? -92.22 -69.77 13 2 ASN A 58 ? ? -150.35 -97.47 14 3 PHE A 7 ? ? -166.52 114.15 15 3 ASN A 27 ? ? 69.65 -0.85 16 3 ASN A 31 ? ? -146.29 -2.85 17 3 SER A 32 ? ? 66.68 -17.75 18 3 CYS A 34 ? ? -42.31 158.60 19 3 CYS A 42 ? ? -132.04 -49.44 20 3 ASN A 58 ? ? -142.79 -74.75 21 3 SER A 59 ? ? -106.17 -67.44 22 4 THR A 16 ? ? -101.75 40.01 23 4 ASN A 31 ? ? -142.85 -63.62 24 4 SER A 32 ? ? 144.50 -0.08 25 4 ASN A 58 ? ? -98.82 -66.96 26 5 ASP A 2 ? ? 94.09 143.75 27 5 PHE A 7 ? ? -160.41 82.72 28 5 ASP A 14 ? ? -138.15 -34.33 29 5 ASN A 17 ? ? -88.02 -72.95 30 5 SER A 18 ? ? 144.08 -64.03 31 5 ASN A 31 ? ? -150.44 -46.61 32 5 CYS A 34 ? ? 42.01 -144.45 33 5 ASN A 58 ? ? -151.42 -88.73 34 6 ASP A 14 ? ? -141.40 -42.92 35 6 ASN A 31 ? ? -146.71 -0.12 36 6 SER A 33 ? ? -148.19 -29.05 37 6 CYS A 34 ? ? -35.76 146.86 38 6 ASN A 58 ? ? -97.03 -82.80 39 7 ASP A 8 ? ? -153.69 77.14 40 7 THR A 11 ? ? -69.73 55.86 41 7 ASN A 12 ? ? -145.60 -38.77 42 7 ASP A 14 ? ? -105.38 -64.25 43 7 GLN A 19 ? ? -95.31 -60.55 44 7 ASN A 31 ? ? -160.38 3.05 45 7 SER A 32 ? ? 67.87 166.74 46 7 SER A 33 ? ? 60.96 -3.86 47 7 PHE A 56 ? ? -104.29 -78.04 48 7 ASN A 58 ? ? -143.77 -144.11 49 8 ASP A 8 ? ? -154.45 78.23 50 8 ASP A 14 ? ? -143.58 -27.85 51 8 SER A 18 ? ? -73.39 37.72 52 8 GLN A 19 ? ? -147.90 -55.12 53 8 THR A 26 ? ? -68.23 2.34 54 8 ASN A 31 ? ? -157.64 -57.92 55 8 SER A 33 ? ? -65.90 8.77 56 8 CYS A 34 ? ? 43.19 -146.71 57 8 ASP A 44 ? ? -58.46 179.70 58 8 ASN A 58 ? ? -96.51 -71.26 59 9 ASP A 2 ? ? 67.03 154.76 60 9 THR A 11 ? ? -65.48 23.20 61 9 ASP A 14 ? ? -135.83 -53.56 62 9 ASN A 31 ? ? -134.53 -48.81 63 9 CYS A 34 ? ? 41.26 -141.97 64 9 CYS A 42 ? ? -131.14 -30.94 65 9 ASN A 58 ? ? -126.99 -67.23 66 9 SER A 59 ? ? -139.25 -54.22 67 10 ASP A 2 ? ? 70.89 143.81 68 10 GLU A 5 ? ? -130.21 -159.63 69 10 THR A 11 ? ? -67.99 19.02 70 10 ASN A 31 ? ? -150.88 6.57 71 10 SER A 32 ? ? 60.91 -176.90 72 10 SER A 33 ? ? 74.91 -19.58 73 10 CYS A 42 ? ? -134.04 -50.94 74 10 ALA A 55 ? ? -92.18 -65.16 75 10 ASN A 58 ? ? -144.66 -95.26 76 11 ASP A 8 ? ? -155.11 76.59 77 11 THR A 11 ? ? -75.26 45.46 78 11 ASN A 31 ? ? -162.45 -0.42 79 11 SER A 32 ? ? 67.34 173.21 80 11 SER A 33 ? ? 63.37 -6.51 81 11 ASN A 58 ? ? -151.34 -60.84 82 11 SER A 59 ? ? -122.53 -79.26 83 12 GLU A 5 ? ? -124.10 -161.31 84 12 ASP A 8 ? ? -154.96 66.97 85 12 THR A 11 ? ? -79.15 29.37 86 12 SER A 32 ? ? 69.55 179.62 87 12 SER A 33 ? ? 61.14 -4.51 88 12 ASP A 44 ? ? -59.57 171.87 89 12 ASN A 58 ? ? -146.27 -95.51 90 12 LEU A 61 ? ? -100.90 -66.89 91 13 ASP A 8 ? ? -150.87 64.07 92 13 ASN A 12 ? ? -151.32 -35.18 93 13 SER A 18 ? ? 144.35 -69.11 94 13 ASN A 31 ? ? -147.78 -82.48 95 13 SER A 33 ? ? 68.55 -13.02 96 13 PHE A 56 ? ? -105.26 -66.09 97 13 ASN A 58 ? ? -139.59 -93.14 98 13 LEU A 61 ? ? -72.15 -70.76 99 14 THR A 11 ? ? -84.81 34.27 100 14 THR A 16 ? ? -108.48 42.17 101 14 ASN A 31 ? ? -156.79 2.88 102 14 SER A 32 ? ? 53.57 -169.20 103 14 SER A 33 ? ? 59.12 -16.21 104 14 ASN A 58 ? ? -132.15 -82.95 105 15 ASP A 2 ? ? 71.54 146.36 106 15 ASN A 10 ? ? -57.68 170.83 107 15 GLN A 19 ? ? -100.20 -65.12 108 15 ASN A 31 ? ? -158.07 -4.64 109 15 SER A 32 ? ? 74.50 179.32 110 15 SER A 33 ? ? 61.30 -5.83 111 15 PHE A 56 ? ? -95.67 -64.48 112 15 ASN A 58 ? ? -148.45 -93.67 113 15 LEU A 61 ? ? -82.23 -70.42 114 16 ASP A 2 ? ? 61.39 159.43 115 16 GLU A 5 ? ? -93.65 33.49 116 16 HIS A 6 ? ? -136.20 -76.25 117 16 PHE A 7 ? ? 24.23 82.39 118 16 THR A 11 ? ? -76.94 43.23 119 16 THR A 16 ? ? -142.34 14.40 120 16 GLN A 19 ? ? -129.12 -59.71 121 16 ASN A 31 ? ? -163.19 -3.39 122 16 SER A 33 ? ? -159.08 -27.65 123 16 CYS A 34 ? ? -39.48 121.04 124 16 ASN A 58 ? ? -155.13 -89.07 125 17 ASP A 14 ? ? -142.52 -67.46 126 17 ASN A 27 ? ? 57.23 17.75 127 17 ASN A 58 ? ? -74.45 -83.96 128 18 ASP A 8 ? ? -161.21 82.53 129 18 ASP A 14 ? ? -135.25 -36.47 130 18 ASN A 31 ? ? -126.94 -67.63 131 18 SER A 32 ? ? 162.75 9.25 132 18 SER A 33 ? ? -121.92 -74.16 133 18 CYS A 34 ? ? 39.18 -179.92 134 18 ASP A 44 ? ? -56.14 176.88 135 18 ASN A 58 ? ? -81.80 -144.58 136 19 THR A 11 ? ? -69.52 35.55 137 19 ASN A 12 ? ? -141.25 -25.27 138 19 ASN A 31 ? ? -144.83 -8.69 139 19 SER A 32 ? ? 83.61 -19.17 140 19 SER A 33 ? ? -97.16 -65.21 141 19 CYS A 34 ? ? 40.54 -152.34 142 19 ASN A 58 ? ? -145.06 -75.14 143 19 SER A 59 ? ? -121.38 -60.97 144 20 THR A 11 ? ? -67.49 4.42 145 20 ASP A 14 ? ? -149.39 -32.31 146 20 ASN A 31 ? ? -160.82 -71.83 147 20 SER A 32 ? ? -124.59 -167.43 148 20 SER A 33 ? ? -68.16 2.21 149 20 CYS A 34 ? ? 50.08 -151.37 150 20 ALA A 55 ? ? -92.58 -70.68 151 20 ASN A 58 ? ? -156.84 -143.90 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 52 ? ? 0.081 'SIDE CHAIN' 2 2 TYR A 28 ? ? 0.124 'SIDE CHAIN' 3 4 TYR A 28 ? ? 0.090 'SIDE CHAIN' 4 5 PHE A 7 ? ? 0.097 'SIDE CHAIN' 5 6 TYR A 15 ? ? 0.087 'SIDE CHAIN' 6 6 TYR A 28 ? ? 0.090 'SIDE CHAIN' 7 11 TYR A 15 ? ? 0.066 'SIDE CHAIN' 8 11 TYR A 28 ? ? 0.089 'SIDE CHAIN' 9 17 TYR A 24 ? ? 0.091 'SIDE CHAIN' 10 17 ARG A 52 ? ? 0.083 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JMS _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JMS _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM En-6, 20 mM sodium phosphate, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM En-6, 20 mM sodium phosphate, 100% D2O' 2 '100% D2O' '1 mM En-6, 20 mM sodium phosphate, 1 mM DSS, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id En-6 1 mM ? 1 'sodium phosphate' 20 mM ? 1 En-6 1 mM ? 2 'sodium phosphate' 20 mM ? 2 En-6 1 mM ? 3 'sodium phosphate' 20 mM ? 3 DSS 1 mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D DQF-COSY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '2D 1H-1H NOESY' 1 5 3 '1D 1H' # _pdbx_nmr_refine.details ;CYANA-1.2, used within the 7-cycle iterated ATNOS/CANDID/CYANA procedure and OPALp, applied to the final conformer bundle from ATNOS/CANDID/CYANA ; _pdbx_nmr_refine.entry_id 2JMS _pdbx_nmr_refine.method 'torsion angle dynamics, energy minimization' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.5.3 1 'Bruker Biospin' collection XwinNMR ? 2 'Herrmann, Guntert and Wuthrich' 'peak assignment' ATNOS/CANDID 1.1 3 'Herrmann, Guntert and Wuthrich' 'structure solution' ATNOS/CANDID 1.1 4 'Guntert, Mumenthaler and Wuthrich' 'peak picking' CYANA 1.2 5 'Koradi, Billeter and Guntert' refinement OPAL p 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 PHE N N N N 202 PHE CA C N S 203 PHE C C N N 204 PHE O O N N 205 PHE CB C N N 206 PHE CG C Y N 207 PHE CD1 C Y N 208 PHE CD2 C Y N 209 PHE CE1 C Y N 210 PHE CE2 C Y N 211 PHE CZ C Y N 212 PHE OXT O N N 213 PHE H H N N 214 PHE H2 H N N 215 PHE HA H N N 216 PHE HB2 H N N 217 PHE HB3 H N N 218 PHE HD1 H N N 219 PHE HD2 H N N 220 PHE HE1 H N N 221 PHE HE2 H N N 222 PHE HZ H N N 223 PHE HXT H N N 224 PRO N N N N 225 PRO CA C N S 226 PRO C C N N 227 PRO O O N N 228 PRO CB C N N 229 PRO CG C N N 230 PRO CD C N N 231 PRO OXT O N N 232 PRO H H N N 233 PRO HA H N N 234 PRO HB2 H N N 235 PRO HB3 H N N 236 PRO HG2 H N N 237 PRO HG3 H N N 238 PRO HD2 H N N 239 PRO HD3 H N N 240 PRO HXT H N N 241 SER N N N N 242 SER CA C N S 243 SER C C N N 244 SER O O N N 245 SER CB C N N 246 SER OG O N N 247 SER OXT O N N 248 SER H H N N 249 SER H2 H N N 250 SER HA H N N 251 SER HB2 H N N 252 SER HB3 H N N 253 SER HG H N N 254 SER HXT H N N 255 THR N N N N 256 THR CA C N S 257 THR C C N N 258 THR O O N N 259 THR CB C N R 260 THR OG1 O N N 261 THR CG2 C N N 262 THR OXT O N N 263 THR H H N N 264 THR H2 H N N 265 THR HA H N N 266 THR HB H N N 267 THR HG1 H N N 268 THR HG21 H N N 269 THR HG22 H N N 270 THR HG23 H N N 271 THR HXT H N N 272 TRP N N N N 273 TRP CA C N S 274 TRP C C N N 275 TRP O O N N 276 TRP CB C N N 277 TRP CG C Y N 278 TRP CD1 C Y N 279 TRP CD2 C Y N 280 TRP NE1 N Y N 281 TRP CE2 C Y N 282 TRP CE3 C Y N 283 TRP CZ2 C Y N 284 TRP CZ3 C Y N 285 TRP CH2 C Y N 286 TRP OXT O N N 287 TRP H H N N 288 TRP H2 H N N 289 TRP HA H N N 290 TRP HB2 H N N 291 TRP HB3 H N N 292 TRP HD1 H N N 293 TRP HE1 H N N 294 TRP HE3 H N N 295 TRP HZ2 H N N 296 TRP HZ3 H N N 297 TRP HH2 H N N 298 TRP HXT H N N 299 TYR N N N N 300 TYR CA C N S 301 TYR C C N N 302 TYR O O N N 303 TYR CB C N N 304 TYR CG C Y N 305 TYR CD1 C Y N 306 TYR CD2 C Y N 307 TYR CE1 C Y N 308 TYR CE2 C Y N 309 TYR CZ C Y N 310 TYR OH O N N 311 TYR OXT O N N 312 TYR H H N N 313 TYR H2 H N N 314 TYR HA H N N 315 TYR HB2 H N N 316 TYR HB3 H N N 317 TYR HD1 H N N 318 TYR HD2 H N N 319 TYR HE1 H N N 320 TYR HE2 H N N 321 TYR HH H N N 322 TYR HXT H N N 323 VAL N N N N 324 VAL CA C N S 325 VAL C C N N 326 VAL O O N N 327 VAL CB C N N 328 VAL CG1 C N N 329 VAL CG2 C N N 330 VAL OXT O N N 331 VAL H H N N 332 VAL H2 H N N 333 VAL HA H N N 334 VAL HB H N N 335 VAL HG11 H N N 336 VAL HG12 H N N 337 VAL HG13 H N N 338 VAL HG21 H N N 339 VAL HG22 H N N 340 VAL HG23 H N N 341 VAL HXT H N N 342 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 PHE N CA sing N N 192 PHE N H sing N N 193 PHE N H2 sing N N 194 PHE CA C sing N N 195 PHE CA CB sing N N 196 PHE CA HA sing N N 197 PHE C O doub N N 198 PHE C OXT sing N N 199 PHE CB CG sing N N 200 PHE CB HB2 sing N N 201 PHE CB HB3 sing N N 202 PHE CG CD1 doub Y N 203 PHE CG CD2 sing Y N 204 PHE CD1 CE1 sing Y N 205 PHE CD1 HD1 sing N N 206 PHE CD2 CE2 doub Y N 207 PHE CD2 HD2 sing N N 208 PHE CE1 CZ doub Y N 209 PHE CE1 HE1 sing N N 210 PHE CE2 CZ sing Y N 211 PHE CE2 HE2 sing N N 212 PHE CZ HZ sing N N 213 PHE OXT HXT sing N N 214 PRO N CA sing N N 215 PRO N CD sing N N 216 PRO N H sing N N 217 PRO CA C sing N N 218 PRO CA CB sing N N 219 PRO CA HA sing N N 220 PRO C O doub N N 221 PRO C OXT sing N N 222 PRO CB CG sing N N 223 PRO CB HB2 sing N N 224 PRO CB HB3 sing N N 225 PRO CG CD sing N N 226 PRO CG HG2 sing N N 227 PRO CG HG3 sing N N 228 PRO CD HD2 sing N N 229 PRO CD HD3 sing N N 230 PRO OXT HXT sing N N 231 SER N CA sing N N 232 SER N H sing N N 233 SER N H2 sing N N 234 SER CA C sing N N 235 SER CA CB sing N N 236 SER CA HA sing N N 237 SER C O doub N N 238 SER C OXT sing N N 239 SER CB OG sing N N 240 SER CB HB2 sing N N 241 SER CB HB3 sing N N 242 SER OG HG sing N N 243 SER OXT HXT sing N N 244 THR N CA sing N N 245 THR N H sing N N 246 THR N H2 sing N N 247 THR CA C sing N N 248 THR CA CB sing N N 249 THR CA HA sing N N 250 THR C O doub N N 251 THR C OXT sing N N 252 THR CB OG1 sing N N 253 THR CB CG2 sing N N 254 THR CB HB sing N N 255 THR OG1 HG1 sing N N 256 THR CG2 HG21 sing N N 257 THR CG2 HG22 sing N N 258 THR CG2 HG23 sing N N 259 THR OXT HXT sing N N 260 TRP N CA sing N N 261 TRP N H sing N N 262 TRP N H2 sing N N 263 TRP CA C sing N N 264 TRP CA CB sing N N 265 TRP CA HA sing N N 266 TRP C O doub N N 267 TRP C OXT sing N N 268 TRP CB CG sing N N 269 TRP CB HB2 sing N N 270 TRP CB HB3 sing N N 271 TRP CG CD1 doub Y N 272 TRP CG CD2 sing Y N 273 TRP CD1 NE1 sing Y N 274 TRP CD1 HD1 sing N N 275 TRP CD2 CE2 doub Y N 276 TRP CD2 CE3 sing Y N 277 TRP NE1 CE2 sing Y N 278 TRP NE1 HE1 sing N N 279 TRP CE2 CZ2 sing Y N 280 TRP CE3 CZ3 doub Y N 281 TRP CE3 HE3 sing N N 282 TRP CZ2 CH2 doub Y N 283 TRP CZ2 HZ2 sing N N 284 TRP CZ3 CH2 sing Y N 285 TRP CZ3 HZ3 sing N N 286 TRP CH2 HH2 sing N N 287 TRP OXT HXT sing N N 288 TYR N CA sing N N 289 TYR N H sing N N 290 TYR N H2 sing N N 291 TYR CA C sing N N 292 TYR CA CB sing N N 293 TYR CA HA sing N N 294 TYR C O doub N N 295 TYR C OXT sing N N 296 TYR CB CG sing N N 297 TYR CB HB2 sing N N 298 TYR CB HB3 sing N N 299 TYR CG CD1 doub Y N 300 TYR CG CD2 sing Y N 301 TYR CD1 CE1 sing Y N 302 TYR CD1 HD1 sing N N 303 TYR CD2 CE2 doub Y N 304 TYR CD2 HD2 sing N N 305 TYR CE1 CZ doub Y N 306 TYR CE1 HE1 sing N N 307 TYR CE2 CZ sing Y N 308 TYR CE2 HE2 sing N N 309 TYR CZ OH sing N N 310 TYR OH HH sing N N 311 TYR OXT HXT sing N N 312 VAL N CA sing N N 313 VAL N H sing N N 314 VAL N H2 sing N N 315 VAL CA C sing N N 316 VAL CA CB sing N N 317 VAL CA HA sing N N 318 VAL C O doub N N 319 VAL C OXT sing N N 320 VAL CB CG1 sing N N 321 VAL CB CG2 sing N N 322 VAL CB HB sing N N 323 VAL CG1 HG11 sing N N 324 VAL CG1 HG12 sing N N 325 VAL CG1 HG13 sing N N 326 VAL CG2 HG21 sing N N 327 VAL CG2 HG22 sing N N 328 VAL CG2 HG23 sing N N 329 VAL OXT HXT sing N N 330 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2JMS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_