data_2JOV # _entry.id 2JOV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JOV pdb_00002jov 10.2210/pdb2jov/pdb RCSB RCSB100103 ? ? WWPDB D_1000100103 ? ? BMRB 15203 ? 10.13018/BMR15203 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-08 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-05 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2023-12-20 7 'Structure model' 1 6 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Experimental preparation' 7 4 'Structure model' Other 8 5 'Structure model' 'Database references' 9 5 'Structure model' Other 10 6 'Structure model' 'Data collection' 11 6 'Structure model' Other 12 7 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_sample_details 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' pdbx_struct_assembly 7 4 'Structure model' pdbx_struct_oper_list 8 4 'Structure model' struct_ref_seq_dif 9 5 'Structure model' database_2 10 5 'Structure model' pdbx_database_status 11 6 'Structure model' chem_comp_atom 12 6 'Structure model' chem_comp_bond 13 6 'Structure model' pdbx_database_status 14 7 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_sample_details.contents' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_database_2.pdbx_DOI' 7 5 'Structure model' '_database_2.pdbx_database_accession' 8 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 9 6 'Structure model' '_pdbx_database_status.deposit_site' 10 7 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JOV _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-04-04 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 15203 . unspecified TargetDB CpR31 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ding, K.' 1 'Ramelot, T.A.' 2 'Anklin, C.G.' 3 'Wang, H.' 4 'Nwosu, C.' 5 'Cunningham, K.' 6 'Ma, L.' 7 'Xiao, R.' 8 'Liu, J.' 9 'Baran, M.C.' 10 'Swapna, G.V.T.' 11 'Acton, T.B.' 12 'Rost, B.' 13 'Montelione, G.T.' 14 'Kennedy, M.A.' 15 'Northeast Structural Genomics Consortium (NESG)' 16 # _citation.id primary _citation.title 'NMR structure of Clostridium perfringens protein CPE0013.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ding, K.' 1 ? primary 'Ramelot, T.A.' 2 ? primary 'Wang, H.' 3 ? primary 'Nwosu, C.' 4 ? primary 'Montelione, G.T.' 5 ? primary 'Kennedy, M.A.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein CPE0013' _entity.formula_weight 9679.284 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSLEH HHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDSLEH HHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CpR31 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 LYS n 1 4 ASP n 1 5 ILE n 1 6 PHE n 1 7 THR n 1 8 SER n 1 9 VAL n 1 10 VAL n 1 11 ARG n 1 12 VAL n 1 13 ARG n 1 14 GLY n 1 15 SER n 1 16 LYS n 1 17 LYS n 1 18 TYR n 1 19 ASN n 1 20 VAL n 1 21 VAL n 1 22 PRO n 1 23 VAL n 1 24 LYS n 1 25 SER n 1 26 ASN n 1 27 LYS n 1 28 PRO n 1 29 VAL n 1 30 GLU n 1 31 ILE n 1 32 SER n 1 33 LYS n 1 34 TRP n 1 35 ILE n 1 36 ASP n 1 37 PHE n 1 38 SER n 1 39 ASN n 1 40 VAL n 1 41 LEU n 1 42 SER n 1 43 ARG n 1 44 LEU n 1 45 TYR n 1 46 VAL n 1 47 GLY n 1 48 VAL n 1 49 PRO n 1 50 THR n 1 51 LYS n 1 52 SER n 1 53 GLY n 1 54 ASN n 1 55 VAL n 1 56 VAL n 1 57 CYS n 1 58 LYS n 1 59 ASN n 1 60 ILE n 1 61 MET n 1 62 ASN n 1 63 THR n 1 64 GLY n 1 65 VAL n 1 66 ASP n 1 67 ILE n 1 68 ILE n 1 69 CYS n 1 70 THR n 1 71 LYS n 1 72 ASN n 1 73 LEU n 1 74 PRO n 1 75 LYS n 1 76 ASP n 1 77 SER n 1 78 LEU n 1 79 GLU n 1 80 HIS n 1 81 HIS n 1 82 HIS n 1 83 HIS n 1 84 HIS n 1 85 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Clostridium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium perfringens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1502 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 HIS 85 85 85 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JOV _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2JOV _struct.title 'NMR Structure of Clostridium Perfringens Protein CPE0013. Northeast Structural Genomics Target CpR31.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JOV _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;alpha + beta sandwich, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8XPF0_CLOPE _struct_ref.pdbx_db_accession Q8XPF0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MHKDIFTSVVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNTGVDIICTKNLPKDS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JOV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8XPF0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JOV LEU A 78 ? UNP Q8XPF0 ? ? 'cloning artifact' 78 1 1 2JOV GLU A 79 ? UNP Q8XPF0 ? ? 'cloning artifact' 79 2 1 2JOV HIS A 80 ? UNP Q8XPF0 ? ? 'expression tag' 80 3 1 2JOV HIS A 81 ? UNP Q8XPF0 ? ? 'expression tag' 81 4 1 2JOV HIS A 82 ? UNP Q8XPF0 ? ? 'expression tag' 82 5 1 2JOV HIS A 83 ? UNP Q8XPF0 ? ? 'expression tag' 83 6 1 2JOV HIS A 84 ? UNP Q8XPF0 ? ? 'expression tag' 84 7 1 2JOV HIS A 85 ? UNP Q8XPF0 ? ? 'expression tag' 85 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 30 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 42 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 30 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 42 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 45 ? VAL A 46 ? TYR A 45 VAL A 46 A 2 ASP A 4 ? VAL A 12 ? ASP A 4 VAL A 12 A 3 VAL A 20 ? VAL A 29 ? VAL A 20 VAL A 29 A 4 ASP A 66 ? CYS A 69 ? ASP A 66 CYS A 69 A 5 ASN A 54 ? LYS A 58 ? ASN A 54 LYS A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 46 ? O VAL A 46 N ARG A 11 ? N ARG A 11 A 2 3 N SER A 8 ? N SER A 8 O VAL A 23 ? O VAL A 23 A 3 4 N LYS A 24 ? N LYS A 24 O ILE A 68 ? O ILE A 68 A 4 5 O ILE A 67 ? O ILE A 67 N VAL A 56 ? N VAL A 56 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 33 ? ? OD2 A ASP 36 ? ? 1.60 2 2 HD22 A ASN 54 ? ? HB2 A CYS 69 ? ? 1.32 3 4 HG3 A LYS 58 ? ? HB3 A ASP 66 ? ? 1.30 4 4 OE2 A GLU 30 ? ? HZ3 A LYS 33 ? ? 1.57 5 6 HA A ILE 31 ? ? HD1 A TRP 34 ? ? 1.31 6 7 HD21 A ASN 54 ? ? HB2 A CYS 69 ? ? 1.32 7 10 H1 A MET 1 ? ? OE2 A GLU 30 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 2 ? ? -122.03 -71.48 2 1 LYS A 16 ? ? -149.58 39.77 3 1 LYS A 17 ? ? 70.74 -66.07 4 1 HIS A 83 ? ? -79.04 -91.73 5 1 HIS A 84 ? ? 176.30 142.37 6 2 SER A 15 ? ? -81.55 45.37 7 2 LYS A 16 ? ? -99.00 33.58 8 2 LYS A 17 ? ? 69.74 -59.27 9 2 ASN A 19 ? ? -143.50 11.40 10 2 LEU A 44 ? ? -109.05 42.14 11 2 SER A 77 ? ? -99.31 48.80 12 2 HIS A 81 ? ? 67.45 -75.86 13 2 HIS A 84 ? ? -143.03 -77.36 14 3 PHE A 6 ? ? -59.56 107.39 15 3 LYS A 17 ? ? -83.74 37.70 16 3 ILE A 31 ? ? -77.05 22.54 17 3 VAL A 48 ? ? 70.41 140.01 18 4 VAL A 46 ? ? -141.75 -157.33 19 4 VAL A 48 ? ? 68.28 117.86 20 4 PRO A 49 ? ? -43.29 105.01 21 4 SER A 77 ? ? -146.80 52.28 22 4 HIS A 82 ? ? 65.86 95.35 23 5 ASN A 59 ? ? 55.04 77.68 24 5 MET A 61 ? ? -141.99 54.59 25 6 VAL A 48 ? ? 60.08 79.95 26 6 LYS A 75 ? ? -61.45 -73.90 27 6 SER A 77 ? ? -85.40 32.17 28 6 HIS A 80 ? ? -89.08 32.34 29 6 HIS A 82 ? ? -157.12 -66.14 30 6 HIS A 83 ? ? 158.78 179.79 31 7 HIS A 2 ? ? -171.80 88.62 32 7 VAL A 48 ? ? 75.82 128.27 33 7 LYS A 51 ? ? -127.16 -152.88 34 8 SER A 32 ? ? 70.98 -25.48 35 8 ASN A 62 ? ? 57.80 79.40 36 8 THR A 63 ? ? -138.65 -55.72 37 8 LYS A 75 ? ? -71.99 -75.39 38 8 SER A 77 ? ? 56.54 -85.59 39 8 HIS A 80 ? ? -56.66 -72.50 40 8 HIS A 81 ? ? 63.46 -74.85 41 8 HIS A 82 ? ? -166.93 -72.91 42 8 HIS A 83 ? ? -170.74 142.70 43 9 VAL A 48 ? ? 177.23 141.25 44 9 PRO A 49 ? ? -42.06 105.88 45 9 SER A 52 ? ? 69.20 150.80 46 9 ASN A 62 ? ? 70.67 -2.87 47 9 ASP A 76 ? ? -108.37 -157.83 48 9 GLU A 79 ? ? -81.89 40.49 49 9 HIS A 83 ? ? -96.24 -67.48 50 10 HIS A 2 ? ? 61.17 94.54 51 10 SER A 32 ? ? -155.71 -30.96 52 10 VAL A 48 ? ? 68.22 101.27 53 10 PRO A 49 ? ? -58.33 108.45 54 10 THR A 50 ? ? -108.84 -165.27 55 10 ASN A 59 ? ? 65.25 79.71 56 10 MET A 61 ? ? 68.77 -76.33 57 10 ASN A 62 ? ? -178.90 82.80 58 10 THR A 63 ? ? -141.83 -44.02 59 11 HIS A 2 ? ? -153.93 -66.27 60 11 ASN A 19 ? ? -131.31 -34.69 61 11 LYS A 51 ? ? -97.31 -146.94 62 11 ASN A 62 ? ? 65.02 98.70 63 11 THR A 63 ? ? -171.46 -34.89 64 11 HIS A 80 ? ? 55.18 88.91 65 11 HIS A 81 ? ? -67.72 99.37 66 11 HIS A 82 ? ? -158.20 -66.97 67 11 HIS A 84 ? ? 55.95 79.00 68 12 VAL A 48 ? ? 72.49 126.13 69 12 VAL A 56 ? ? -94.42 -75.81 70 12 ASP A 76 ? ? -55.29 108.15 71 12 LEU A 78 ? ? 65.33 112.75 72 12 HIS A 81 ? ? 65.63 167.62 73 13 HIS A 2 ? ? 52.02 81.70 74 13 PHE A 6 ? ? -59.31 98.77 75 13 SER A 8 ? ? -152.78 -159.39 76 13 TYR A 18 ? ? -174.09 143.84 77 13 ASN A 59 ? ? 62.94 60.26 78 13 ASN A 62 ? ? 60.14 76.37 79 13 LYS A 75 ? ? -130.70 -59.81 80 13 HIS A 83 ? ? -157.78 -47.65 81 13 HIS A 84 ? ? -179.82 -40.28 82 14 LYS A 51 ? ? -101.90 78.22 83 14 SER A 52 ? ? 68.43 159.72 84 14 ASN A 59 ? ? 62.46 75.69 85 14 MET A 61 ? ? 66.38 -80.37 86 14 ASN A 62 ? ? 172.47 80.83 87 14 THR A 63 ? ? -158.48 15.11 88 14 GLU A 79 ? ? -91.14 37.50 89 14 HIS A 81 ? ? 75.75 -58.39 90 14 HIS A 83 ? ? -140.68 11.27 91 14 HIS A 84 ? ? 72.19 144.15 92 15 VAL A 48 ? ? 71.46 115.57 93 15 ASN A 62 ? ? 53.81 72.51 94 15 THR A 63 ? ? -153.89 13.67 95 15 LYS A 75 ? ? -69.95 -71.23 96 15 SER A 77 ? ? -69.34 99.73 97 15 HIS A 84 ? ? -166.24 -58.60 98 16 SER A 15 ? ? -77.93 20.43 99 16 SER A 32 ? ? 72.69 -32.77 100 16 VAL A 48 ? ? 73.53 134.29 101 16 ASN A 62 ? ? 56.71 5.86 102 16 ASP A 76 ? ? 63.13 -169.64 103 16 HIS A 81 ? ? 70.30 167.92 104 17 LYS A 51 ? ? -98.27 -149.76 105 17 SER A 77 ? ? -174.48 127.33 106 17 HIS A 83 ? ? -162.50 40.76 107 17 HIS A 84 ? ? -79.03 47.75 108 18 HIS A 2 ? ? 62.10 -94.86 109 18 PHE A 6 ? ? -58.80 106.66 110 18 LYS A 16 ? ? -169.96 -168.92 111 18 ARG A 43 ? ? -141.64 16.75 112 18 LEU A 44 ? ? -115.10 59.43 113 18 ASP A 76 ? ? 79.20 -177.09 114 19 HIS A 2 ? ? -142.62 17.94 115 19 PHE A 6 ? ? -59.35 108.50 116 19 SER A 8 ? ? -155.79 -156.79 117 19 LYS A 16 ? ? -171.78 -166.63 118 19 ASN A 19 ? ? -136.12 -50.07 119 19 LEU A 44 ? ? -74.07 -71.66 120 19 TYR A 45 ? ? 58.50 79.92 121 19 ASN A 62 ? ? 62.75 82.68 122 19 HIS A 82 ? ? -161.72 96.73 123 19 HIS A 83 ? ? -171.36 -55.94 124 20 LYS A 17 ? ? -91.71 34.14 125 20 ILE A 31 ? ? -68.26 81.41 126 20 SER A 32 ? ? 179.90 -40.91 127 20 VAL A 48 ? ? 71.97 139.75 128 20 LYS A 51 ? ? -101.59 -148.80 129 20 LYS A 75 ? ? -95.38 -82.79 130 20 HIS A 82 ? ? -145.54 -76.05 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JOV _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JOV _pdbx_nmr_representative.selection_criteria 'lowest total energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] protein, 20 mM MES, 100 mM NaCl, 10 mM DTT, 5 mM CaCl2, 0.02 % NaN3, 5 % D2O, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1 mM [U-100% 13C; U-100% 15N] protein, 20 mM MES, 100 mM NaCl, 10 mM DTT, 5 mM CaCl2, 0.02 % NaN3, 100% D2O' 2 '100% D2O' '1 mM [U-5% 13C; U-100% 15N] protein, 20 mM MES, 100 mM NaCl, 10 mM DTT, 5 mM CaCl2, 0.02 % NaN3, 5 % D2O, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein 1 mM '[U-100% 13C; U-100% 15N]' 1 MES 20 mM ? 1 NaCl 100 mM ? 1 DTT 10 mM ? 1 CaCl2 5 mM ? 1 NaN3 0.02 % ? 1 D2O 5 % ? 1 protein 1 mM '[U-100% 13C; U-100% 15N]' 2 MES 20 mM ? 2 NaCl 100 mM ? 2 DTT 10 mM ? 2 CaCl2 5 mM ? 2 NaN3 0.02 % ? 2 protein 1 mM '[U-5% 13C; U-100% 15N]' 3 MES 20 mM ? 3 NaCl 100 mM ? 3 DTT 10 mM ? 3 CaCl2 5 mM ? 3 NaN3 0.02 % ? 3 D2O 5 % ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCACB' 1 7 2 '2D 1H-13C HSQC' 1 8 3 '2D 1H-13C HSQC' 1 9 1 '3D HBHA(CO)NH' 1 10 2 '3D HCCH-TOCSY' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D 1H-13C NOESY' 1 13 2 '3D 1H-13C NOESY' # _pdbx_nmr_refine.details 'DGSA calculation using xplor NIH and then followed by CNS water refinement.' _pdbx_nmr_refine.entry_id 2JOV _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 1 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.15.0 2 'Huang, Swapana, Rajan, Ke, Xia, Shukla, Inouye and Montelione' 'data analysis' AutoStructure ? 3 Goddard 'data analysis' Sparky ? 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLU N N N N 75 GLU CA C N S 76 GLU C C N N 77 GLU O O N N 78 GLU CB C N N 79 GLU CG C N N 80 GLU CD C N N 81 GLU OE1 O N N 82 GLU OE2 O N N 83 GLU OXT O N N 84 GLU H H N N 85 GLU H2 H N N 86 GLU HA H N N 87 GLU HB2 H N N 88 GLU HB3 H N N 89 GLU HG2 H N N 90 GLU HG3 H N N 91 GLU HE2 H N N 92 GLU HXT H N N 93 GLY N N N N 94 GLY CA C N N 95 GLY C C N N 96 GLY O O N N 97 GLY OXT O N N 98 GLY H H N N 99 GLY H2 H N N 100 GLY HA2 H N N 101 GLY HA3 H N N 102 GLY HXT H N N 103 HIS N N N N 104 HIS CA C N S 105 HIS C C N N 106 HIS O O N N 107 HIS CB C N N 108 HIS CG C Y N 109 HIS ND1 N Y N 110 HIS CD2 C Y N 111 HIS CE1 C Y N 112 HIS NE2 N Y N 113 HIS OXT O N N 114 HIS H H N N 115 HIS H2 H N N 116 HIS HA H N N 117 HIS HB2 H N N 118 HIS HB3 H N N 119 HIS HD1 H N N 120 HIS HD2 H N N 121 HIS HE1 H N N 122 HIS HE2 H N N 123 HIS HXT H N N 124 ILE N N N N 125 ILE CA C N S 126 ILE C C N N 127 ILE O O N N 128 ILE CB C N S 129 ILE CG1 C N N 130 ILE CG2 C N N 131 ILE CD1 C N N 132 ILE OXT O N N 133 ILE H H N N 134 ILE H2 H N N 135 ILE HA H N N 136 ILE HB H N N 137 ILE HG12 H N N 138 ILE HG13 H N N 139 ILE HG21 H N N 140 ILE HG22 H N N 141 ILE HG23 H N N 142 ILE HD11 H N N 143 ILE HD12 H N N 144 ILE HD13 H N N 145 ILE HXT H N N 146 LEU N N N N 147 LEU CA C N S 148 LEU C C N N 149 LEU O O N N 150 LEU CB C N N 151 LEU CG C N N 152 LEU CD1 C N N 153 LEU CD2 C N N 154 LEU OXT O N N 155 LEU H H N N 156 LEU H2 H N N 157 LEU HA H N N 158 LEU HB2 H N N 159 LEU HB3 H N N 160 LEU HG H N N 161 LEU HD11 H N N 162 LEU HD12 H N N 163 LEU HD13 H N N 164 LEU HD21 H N N 165 LEU HD22 H N N 166 LEU HD23 H N N 167 LEU HXT H N N 168 LYS N N N N 169 LYS CA C N S 170 LYS C C N N 171 LYS O O N N 172 LYS CB C N N 173 LYS CG C N N 174 LYS CD C N N 175 LYS CE C N N 176 LYS NZ N N N 177 LYS OXT O N N 178 LYS H H N N 179 LYS H2 H N N 180 LYS HA H N N 181 LYS HB2 H N N 182 LYS HB3 H N N 183 LYS HG2 H N N 184 LYS HG3 H N N 185 LYS HD2 H N N 186 LYS HD3 H N N 187 LYS HE2 H N N 188 LYS HE3 H N N 189 LYS HZ1 H N N 190 LYS HZ2 H N N 191 LYS HZ3 H N N 192 LYS HXT H N N 193 MET N N N N 194 MET CA C N S 195 MET C C N N 196 MET O O N N 197 MET CB C N N 198 MET CG C N N 199 MET SD S N N 200 MET CE C N N 201 MET OXT O N N 202 MET H H N N 203 MET H2 H N N 204 MET HA H N N 205 MET HB2 H N N 206 MET HB3 H N N 207 MET HG2 H N N 208 MET HG3 H N N 209 MET HE1 H N N 210 MET HE2 H N N 211 MET HE3 H N N 212 MET HXT H N N 213 PHE N N N N 214 PHE CA C N S 215 PHE C C N N 216 PHE O O N N 217 PHE CB C N N 218 PHE CG C Y N 219 PHE CD1 C Y N 220 PHE CD2 C Y N 221 PHE CE1 C Y N 222 PHE CE2 C Y N 223 PHE CZ C Y N 224 PHE OXT O N N 225 PHE H H N N 226 PHE H2 H N N 227 PHE HA H N N 228 PHE HB2 H N N 229 PHE HB3 H N N 230 PHE HD1 H N N 231 PHE HD2 H N N 232 PHE HE1 H N N 233 PHE HE2 H N N 234 PHE HZ H N N 235 PHE HXT H N N 236 PRO N N N N 237 PRO CA C N S 238 PRO C C N N 239 PRO O O N N 240 PRO CB C N N 241 PRO CG C N N 242 PRO CD C N N 243 PRO OXT O N N 244 PRO H H N N 245 PRO HA H N N 246 PRO HB2 H N N 247 PRO HB3 H N N 248 PRO HG2 H N N 249 PRO HG3 H N N 250 PRO HD2 H N N 251 PRO HD3 H N N 252 PRO HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 THR N N N N 268 THR CA C N S 269 THR C C N N 270 THR O O N N 271 THR CB C N R 272 THR OG1 O N N 273 THR CG2 C N N 274 THR OXT O N N 275 THR H H N N 276 THR H2 H N N 277 THR HA H N N 278 THR HB H N N 279 THR HG1 H N N 280 THR HG21 H N N 281 THR HG22 H N N 282 THR HG23 H N N 283 THR HXT H N N 284 TRP N N N N 285 TRP CA C N S 286 TRP C C N N 287 TRP O O N N 288 TRP CB C N N 289 TRP CG C Y N 290 TRP CD1 C Y N 291 TRP CD2 C Y N 292 TRP NE1 N Y N 293 TRP CE2 C Y N 294 TRP CE3 C Y N 295 TRP CZ2 C Y N 296 TRP CZ3 C Y N 297 TRP CH2 C Y N 298 TRP OXT O N N 299 TRP H H N N 300 TRP H2 H N N 301 TRP HA H N N 302 TRP HB2 H N N 303 TRP HB3 H N N 304 TRP HD1 H N N 305 TRP HE1 H N N 306 TRP HE3 H N N 307 TRP HZ2 H N N 308 TRP HZ3 H N N 309 TRP HH2 H N N 310 TRP HXT H N N 311 TYR N N N N 312 TYR CA C N S 313 TYR C C N N 314 TYR O O N N 315 TYR CB C N N 316 TYR CG C Y N 317 TYR CD1 C Y N 318 TYR CD2 C Y N 319 TYR CE1 C Y N 320 TYR CE2 C Y N 321 TYR CZ C Y N 322 TYR OH O N N 323 TYR OXT O N N 324 TYR H H N N 325 TYR H2 H N N 326 TYR HA H N N 327 TYR HB2 H N N 328 TYR HB3 H N N 329 TYR HD1 H N N 330 TYR HD2 H N N 331 TYR HE1 H N N 332 TYR HE2 H N N 333 TYR HH H N N 334 TYR HXT H N N 335 VAL N N N N 336 VAL CA C N S 337 VAL C C N N 338 VAL O O N N 339 VAL CB C N N 340 VAL CG1 C N N 341 VAL CG2 C N N 342 VAL OXT O N N 343 VAL H H N N 344 VAL H2 H N N 345 VAL HA H N N 346 VAL HB H N N 347 VAL HG11 H N N 348 VAL HG12 H N N 349 VAL HG13 H N N 350 VAL HG21 H N N 351 VAL HG22 H N N 352 VAL HG23 H N N 353 VAL HXT H N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLU N CA sing N N 71 GLU N H sing N N 72 GLU N H2 sing N N 73 GLU CA C sing N N 74 GLU CA CB sing N N 75 GLU CA HA sing N N 76 GLU C O doub N N 77 GLU C OXT sing N N 78 GLU CB CG sing N N 79 GLU CB HB2 sing N N 80 GLU CB HB3 sing N N 81 GLU CG CD sing N N 82 GLU CG HG2 sing N N 83 GLU CG HG3 sing N N 84 GLU CD OE1 doub N N 85 GLU CD OE2 sing N N 86 GLU OE2 HE2 sing N N 87 GLU OXT HXT sing N N 88 GLY N CA sing N N 89 GLY N H sing N N 90 GLY N H2 sing N N 91 GLY CA C sing N N 92 GLY CA HA2 sing N N 93 GLY CA HA3 sing N N 94 GLY C O doub N N 95 GLY C OXT sing N N 96 GLY OXT HXT sing N N 97 HIS N CA sing N N 98 HIS N H sing N N 99 HIS N H2 sing N N 100 HIS CA C sing N N 101 HIS CA CB sing N N 102 HIS CA HA sing N N 103 HIS C O doub N N 104 HIS C OXT sing N N 105 HIS CB CG sing N N 106 HIS CB HB2 sing N N 107 HIS CB HB3 sing N N 108 HIS CG ND1 sing Y N 109 HIS CG CD2 doub Y N 110 HIS ND1 CE1 doub Y N 111 HIS ND1 HD1 sing N N 112 HIS CD2 NE2 sing Y N 113 HIS CD2 HD2 sing N N 114 HIS CE1 NE2 sing Y N 115 HIS CE1 HE1 sing N N 116 HIS NE2 HE2 sing N N 117 HIS OXT HXT sing N N 118 ILE N CA sing N N 119 ILE N H sing N N 120 ILE N H2 sing N N 121 ILE CA C sing N N 122 ILE CA CB sing N N 123 ILE CA HA sing N N 124 ILE C O doub N N 125 ILE C OXT sing N N 126 ILE CB CG1 sing N N 127 ILE CB CG2 sing N N 128 ILE CB HB sing N N 129 ILE CG1 CD1 sing N N 130 ILE CG1 HG12 sing N N 131 ILE CG1 HG13 sing N N 132 ILE CG2 HG21 sing N N 133 ILE CG2 HG22 sing N N 134 ILE CG2 HG23 sing N N 135 ILE CD1 HD11 sing N N 136 ILE CD1 HD12 sing N N 137 ILE CD1 HD13 sing N N 138 ILE OXT HXT sing N N 139 LEU N CA sing N N 140 LEU N H sing N N 141 LEU N H2 sing N N 142 LEU CA C sing N N 143 LEU CA CB sing N N 144 LEU CA HA sing N N 145 LEU C O doub N N 146 LEU C OXT sing N N 147 LEU CB CG sing N N 148 LEU CB HB2 sing N N 149 LEU CB HB3 sing N N 150 LEU CG CD1 sing N N 151 LEU CG CD2 sing N N 152 LEU CG HG sing N N 153 LEU CD1 HD11 sing N N 154 LEU CD1 HD12 sing N N 155 LEU CD1 HD13 sing N N 156 LEU CD2 HD21 sing N N 157 LEU CD2 HD22 sing N N 158 LEU CD2 HD23 sing N N 159 LEU OXT HXT sing N N 160 LYS N CA sing N N 161 LYS N H sing N N 162 LYS N H2 sing N N 163 LYS CA C sing N N 164 LYS CA CB sing N N 165 LYS CA HA sing N N 166 LYS C O doub N N 167 LYS C OXT sing N N 168 LYS CB CG sing N N 169 LYS CB HB2 sing N N 170 LYS CB HB3 sing N N 171 LYS CG CD sing N N 172 LYS CG HG2 sing N N 173 LYS CG HG3 sing N N 174 LYS CD CE sing N N 175 LYS CD HD2 sing N N 176 LYS CD HD3 sing N N 177 LYS CE NZ sing N N 178 LYS CE HE2 sing N N 179 LYS CE HE3 sing N N 180 LYS NZ HZ1 sing N N 181 LYS NZ HZ2 sing N N 182 LYS NZ HZ3 sing N N 183 LYS OXT HXT sing N N 184 MET N CA sing N N 185 MET N H sing N N 186 MET N H2 sing N N 187 MET CA C sing N N 188 MET CA CB sing N N 189 MET CA HA sing N N 190 MET C O doub N N 191 MET C OXT sing N N 192 MET CB CG sing N N 193 MET CB HB2 sing N N 194 MET CB HB3 sing N N 195 MET CG SD sing N N 196 MET CG HG2 sing N N 197 MET CG HG3 sing N N 198 MET SD CE sing N N 199 MET CE HE1 sing N N 200 MET CE HE2 sing N N 201 MET CE HE3 sing N N 202 MET OXT HXT sing N N 203 PHE N CA sing N N 204 PHE N H sing N N 205 PHE N H2 sing N N 206 PHE CA C sing N N 207 PHE CA CB sing N N 208 PHE CA HA sing N N 209 PHE C O doub N N 210 PHE C OXT sing N N 211 PHE CB CG sing N N 212 PHE CB HB2 sing N N 213 PHE CB HB3 sing N N 214 PHE CG CD1 doub Y N 215 PHE CG CD2 sing Y N 216 PHE CD1 CE1 sing Y N 217 PHE CD1 HD1 sing N N 218 PHE CD2 CE2 doub Y N 219 PHE CD2 HD2 sing N N 220 PHE CE1 CZ doub Y N 221 PHE CE1 HE1 sing N N 222 PHE CE2 CZ sing Y N 223 PHE CE2 HE2 sing N N 224 PHE CZ HZ sing N N 225 PHE OXT HXT sing N N 226 PRO N CA sing N N 227 PRO N CD sing N N 228 PRO N H sing N N 229 PRO CA C sing N N 230 PRO CA CB sing N N 231 PRO CA HA sing N N 232 PRO C O doub N N 233 PRO C OXT sing N N 234 PRO CB CG sing N N 235 PRO CB HB2 sing N N 236 PRO CB HB3 sing N N 237 PRO CG CD sing N N 238 PRO CG HG2 sing N N 239 PRO CG HG3 sing N N 240 PRO CD HD2 sing N N 241 PRO CD HD3 sing N N 242 PRO OXT HXT sing N N 243 SER N CA sing N N 244 SER N H sing N N 245 SER N H2 sing N N 246 SER CA C sing N N 247 SER CA CB sing N N 248 SER CA HA sing N N 249 SER C O doub N N 250 SER C OXT sing N N 251 SER CB OG sing N N 252 SER CB HB2 sing N N 253 SER CB HB3 sing N N 254 SER OG HG sing N N 255 SER OXT HXT sing N N 256 THR N CA sing N N 257 THR N H sing N N 258 THR N H2 sing N N 259 THR CA C sing N N 260 THR CA CB sing N N 261 THR CA HA sing N N 262 THR C O doub N N 263 THR C OXT sing N N 264 THR CB OG1 sing N N 265 THR CB CG2 sing N N 266 THR CB HB sing N N 267 THR OG1 HG1 sing N N 268 THR CG2 HG21 sing N N 269 THR CG2 HG22 sing N N 270 THR CG2 HG23 sing N N 271 THR OXT HXT sing N N 272 TRP N CA sing N N 273 TRP N H sing N N 274 TRP N H2 sing N N 275 TRP CA C sing N N 276 TRP CA CB sing N N 277 TRP CA HA sing N N 278 TRP C O doub N N 279 TRP C OXT sing N N 280 TRP CB CG sing N N 281 TRP CB HB2 sing N N 282 TRP CB HB3 sing N N 283 TRP CG CD1 doub Y N 284 TRP CG CD2 sing Y N 285 TRP CD1 NE1 sing Y N 286 TRP CD1 HD1 sing N N 287 TRP CD2 CE2 doub Y N 288 TRP CD2 CE3 sing Y N 289 TRP NE1 CE2 sing Y N 290 TRP NE1 HE1 sing N N 291 TRP CE2 CZ2 sing Y N 292 TRP CE3 CZ3 doub Y N 293 TRP CE3 HE3 sing N N 294 TRP CZ2 CH2 doub Y N 295 TRP CZ2 HZ2 sing N N 296 TRP CZ3 CH2 sing Y N 297 TRP CZ3 HZ3 sing N N 298 TRP CH2 HH2 sing N N 299 TRP OXT HXT sing N N 300 TYR N CA sing N N 301 TYR N H sing N N 302 TYR N H2 sing N N 303 TYR CA C sing N N 304 TYR CA CB sing N N 305 TYR CA HA sing N N 306 TYR C O doub N N 307 TYR C OXT sing N N 308 TYR CB CG sing N N 309 TYR CB HB2 sing N N 310 TYR CB HB3 sing N N 311 TYR CG CD1 doub Y N 312 TYR CG CD2 sing Y N 313 TYR CD1 CE1 sing Y N 314 TYR CD1 HD1 sing N N 315 TYR CD2 CE2 doub Y N 316 TYR CD2 HD2 sing N N 317 TYR CE1 CZ doub Y N 318 TYR CE1 HE1 sing N N 319 TYR CE2 CZ sing Y N 320 TYR CE2 HE2 sing N N 321 TYR CZ OH sing N N 322 TYR OH HH sing N N 323 TYR OXT HXT sing N N 324 VAL N CA sing N N 325 VAL N H sing N N 326 VAL N H2 sing N N 327 VAL CA C sing N N 328 VAL CA CB sing N N 329 VAL CA HA sing N N 330 VAL C O doub N N 331 VAL C OXT sing N N 332 VAL CB CG1 sing N N 333 VAL CB CG2 sing N N 334 VAL CB HB sing N N 335 VAL CG1 HG11 sing N N 336 VAL CG1 HG12 sing N N 337 VAL CG1 HG13 sing N N 338 VAL CG2 HG21 sing N N 339 VAL CG2 HG22 sing N N 340 VAL CG2 HG23 sing N N 341 VAL OXT HXT sing N N 342 # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2JOV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_