data_2JPN # _entry.id 2JPN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JPN pdb_00002jpn 10.2210/pdb2jpn/pdb RCSB RCSB100131 ? ? WWPDB D_1000100131 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-10 2 'Structure model' 1 1 2007-12-11 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JPN _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-05-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sivakolundu, S.G.' 1 'Lee, T.' 2 'White, S.W.' 3 'Kriwacki, R.W.' 4 # _citation.id primary _citation.title 'Crystallographic and NMR Analyses of UvsW and UvsW.1 from Bacteriophage T4' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 34392 _citation.page_last 34400 _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17878153 _citation.pdbx_database_id_DOI 10.1074/jbc.M705900200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kerr, I.D.' 1 ? primary 'Sivakolundu, S.' 2 ? primary 'Li, Z.' 3 ? primary 'Buchsbaum, J.C.' 4 ? primary 'Knox, L.A.' 5 ? primary 'Kriwacki, R.' 6 ? primary 'White, S.W.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ATP-dependent DNA helicase uvsW' _entity.formula_weight 9096.041 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues, 512-587' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Dar protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF _entity_poly.pdbx_seq_one_letter_code_can GSHMLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 LEU n 1 6 LEU n 1 7 GLU n 1 8 PHE n 1 9 LYS n 1 10 GLN n 1 11 PHE n 1 12 LEU n 1 13 TYR n 1 14 GLU n 1 15 ALA n 1 16 SER n 1 17 ILE n 1 18 ASP n 1 19 GLU n 1 20 PHE n 1 21 MET n 1 22 GLY n 1 23 LYS n 1 24 ILE n 1 25 ALA n 1 26 SER n 1 27 CYS n 1 28 GLN n 1 29 THR n 1 30 LEU n 1 31 GLU n 1 32 GLY n 1 33 LEU n 1 34 GLU n 1 35 GLU n 1 36 LEU n 1 37 GLU n 1 38 ALA n 1 39 TYR n 1 40 TYR n 1 41 LYS n 1 42 LYS n 1 43 ARG n 1 44 VAL n 1 45 LYS n 1 46 GLU n 1 47 THR n 1 48 GLU n 1 49 LEU n 1 50 LYS n 1 51 ASP n 1 52 THR n 1 53 ASP n 1 54 ASP n 1 55 ILE n 1 56 SER n 1 57 VAL n 1 58 ARG n 1 59 ASP n 1 60 ALA n 1 61 LEU n 1 62 ALA n 1 63 GLY n 1 64 LYS n 1 65 ARG n 1 66 ALA n 1 67 GLU n 1 68 LEU n 1 69 GLU n 1 70 ASP n 1 71 SER n 1 72 ASP n 1 73 ASP n 1 74 GLU n 1 75 VAL n 1 76 GLU n 1 77 GLU n 1 78 SER n 1 79 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'T4-like viruses' _entity_src_gen.pdbx_gene_src_gene 'uvsW, dar' _entity_src_gen.gene_src_species 'Enterobacteria phage T4 sensu lato' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET15b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 PHE 79 79 79 PHE PHE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JPN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JPN _struct.title 'Solution Structure of T4 Bacteriophage Helicase Uvsw.1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JPN _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'uvsw, bacteriophage helicase, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UVSW_BPT4 _struct_ref.pdbx_db_accession P20703 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MLLEFKQFLYEASIDEFMGKIASCQTLEGLEELEAYYKKRVKETELKDTDDISVRDALAGKRAELEDSDDEVEESF _struct_ref.pdbx_align_begin 512 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JPN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20703 _struct_ref_seq.db_align_beg 512 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 587 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 79 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JPN GLY A 1 ? UNP P20703 ? ? 'cloning artifact' 1 1 1 2JPN SER A 2 ? UNP P20703 ? ? 'cloning artifact' 2 2 1 2JPN HIS A 3 ? UNP P20703 ? ? 'cloning artifact' 3 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 9 ? SER A 16 ? LYS A 9 SER A 16 1 ? 8 HELX_P HELX_P2 2 GLU A 19 ? SER A 26 ? GLU A 19 SER A 26 1 ? 8 HELX_P HELX_P3 3 THR A 29 ? VAL A 44 ? THR A 29 VAL A 44 1 ? 16 HELX_P HELX_P4 4 ASP A 51 ? SER A 71 ? ASP A 51 SER A 71 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 123.65 120.30 3.35 0.50 N 2 2 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 123.82 120.30 3.52 0.50 N 3 2 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.64 120.30 3.34 0.50 N 4 3 CB A TYR 40 ? ? CG A TYR 40 ? ? CD2 A TYR 40 ? ? 116.12 121.00 -4.88 0.60 N 5 3 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.45 120.30 3.15 0.50 N 6 4 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.35 120.30 4.05 0.50 N 7 4 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.51 120.30 3.21 0.50 N 8 5 CA A ILE 24 ? ? CB A ILE 24 ? ? CG1 A ILE 24 ? ? 123.30 111.00 12.30 1.90 N 9 5 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.54 120.30 3.24 0.50 N 10 7 CB A LEU 36 ? ? CG A LEU 36 ? ? CD1 A LEU 36 ? ? 122.06 111.00 11.06 1.70 N 11 7 CB A TYR 40 ? ? CG A TYR 40 ? ? CD2 A TYR 40 ? ? 115.53 121.00 -5.47 0.60 N 12 7 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 123.97 120.30 3.67 0.50 N 13 8 CB A LEU 36 ? ? CG A LEU 36 ? ? CD1 A LEU 36 ? ? 122.81 111.00 11.81 1.70 N 14 8 CB A LEU 49 ? ? CG A LEU 49 ? ? CD1 A LEU 49 ? ? 122.04 111.00 11.04 1.70 N 15 8 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.30 120.30 3.00 0.50 N 16 9 CB A LYS 23 ? ? CA A LYS 23 ? ? C A LYS 23 ? ? 125.22 110.40 14.82 2.00 N 17 9 NE A ARG 58 ? ? CZ A ARG 58 ? ? NH1 A ARG 58 ? ? 123.33 120.30 3.03 0.50 N 18 9 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.47 120.30 3.17 0.50 N 19 10 CB A TYR 40 ? ? CG A TYR 40 ? ? CD2 A TYR 40 ? ? 116.64 121.00 -4.36 0.60 N 20 12 CB A LEU 36 ? ? CG A LEU 36 ? ? CD1 A LEU 36 ? ? 122.25 111.00 11.25 1.70 N 21 12 CA A VAL 44 ? ? CB A VAL 44 ? ? CG1 A VAL 44 ? ? 120.54 110.90 9.64 1.50 N 22 13 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.41 120.30 4.11 0.50 N 23 13 CA A VAL 44 ? ? CB A VAL 44 ? ? CG1 A VAL 44 ? ? 120.40 110.90 9.50 1.50 N 24 13 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.53 120.30 3.23 0.50 N 25 14 CA A ILE 24 ? ? CB A ILE 24 ? ? CG1 A ILE 24 ? ? 123.40 111.00 12.40 1.90 N 26 14 CA A THR 52 ? ? CB A THR 52 ? ? CG2 A THR 52 ? ? 123.08 112.40 10.68 1.40 N 27 14 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.54 120.30 3.24 0.50 N 28 15 CB A LYS 23 ? ? CA A LYS 23 ? ? C A LYS 23 ? ? 123.78 110.40 13.38 2.00 N 29 15 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 123.98 120.30 3.68 0.50 N 30 15 CA A VAL 57 ? ? CB A VAL 57 ? ? CG2 A VAL 57 ? ? 121.93 110.90 11.03 1.50 N 31 15 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.80 120.30 3.50 0.50 N 32 16 CB A LEU 49 ? ? CG A LEU 49 ? ? CD1 A LEU 49 ? ? 121.40 111.00 10.40 1.70 N 33 17 CA A ILE 24 ? ? CB A ILE 24 ? ? CG1 A ILE 24 ? ? 123.14 111.00 12.14 1.90 N 34 17 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.63 120.30 3.33 0.50 N 35 18 CA A ILE 24 ? ? CB A ILE 24 ? ? CG1 A ILE 24 ? ? 122.97 111.00 11.97 1.90 N 36 18 CB A LEU 49 ? ? CG A LEU 49 ? ? CD1 A LEU 49 ? ? 123.26 111.00 12.26 1.70 N 37 18 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.31 120.30 3.01 0.50 N 38 19 CB A LEU 36 ? ? CG A LEU 36 ? ? CD1 A LEU 36 ? ? 122.47 111.00 11.47 1.70 N 39 19 CB A TYR 40 ? ? CG A TYR 40 ? ? CD2 A TYR 40 ? ? 116.07 121.00 -4.93 0.60 N 40 20 NE A ARG 65 ? ? CZ A ARG 65 ? ? NH1 A ARG 65 ? ? 123.56 120.30 3.26 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 6 ? ? 63.44 -21.04 2 1 GLN A 28 ? ? 61.51 -5.93 3 1 THR A 47 ? ? -144.21 -143.81 4 1 LEU A 49 ? ? 53.84 2.97 5 1 LYS A 50 ? ? 39.71 -165.17 6 1 ASP A 73 ? ? -58.91 52.48 7 1 GLU A 76 ? ? 60.18 -35.56 8 1 SER A 78 ? ? -148.05 11.48 9 2 MET A 4 ? ? 56.74 -169.33 10 2 LEU A 6 ? ? -32.89 110.83 11 2 GLU A 19 ? ? -130.45 -59.60 12 2 GLN A 28 ? ? 58.97 -6.91 13 2 THR A 47 ? ? 48.54 114.45 14 2 LEU A 49 ? ? -67.02 85.76 15 2 ASP A 72 ? ? 42.15 18.59 16 2 GLU A 76 ? ? -152.78 -28.61 17 3 SER A 2 ? ? 62.43 -21.93 18 3 GLU A 19 ? ? -133.30 -41.35 19 3 GLN A 28 ? ? 58.57 -5.97 20 3 THR A 47 ? ? -150.37 -133.04 21 3 LEU A 49 ? ? -64.43 91.78 22 3 LYS A 50 ? ? -48.40 167.91 23 3 ASP A 73 ? ? -39.31 123.37 24 3 VAL A 75 ? ? 54.96 -55.67 25 3 GLU A 76 ? ? -145.45 -27.96 26 3 GLU A 77 ? ? -163.97 -56.93 27 3 SER A 78 ? ? -165.00 17.00 28 4 MET A 4 ? ? 62.00 -178.80 29 4 LEU A 6 ? ? -150.93 -32.56 30 4 GLU A 19 ? ? -132.71 -63.57 31 4 GLN A 28 ? ? 63.12 -6.11 32 4 THR A 47 ? ? -153.84 -152.02 33 4 VAL A 75 ? ? 59.60 -53.69 34 4 GLU A 76 ? ? -147.56 -28.98 35 4 GLU A 77 ? ? -165.39 -55.78 36 4 SER A 78 ? ? -169.63 26.88 37 5 MET A 4 ? ? 55.95 169.05 38 5 GLU A 19 ? ? -134.29 -38.69 39 5 GLN A 28 ? ? 61.13 -6.77 40 5 THR A 47 ? ? -129.46 -153.63 41 5 GLU A 76 ? ? 64.00 -37.59 42 5 SER A 78 ? ? -141.79 50.38 43 6 PHE A 8 ? ? 66.57 -19.26 44 6 GLU A 19 ? ? -134.13 -54.20 45 6 GLN A 28 ? ? 61.63 -3.74 46 6 THR A 47 ? ? -142.54 -152.68 47 6 GLU A 76 ? ? 59.91 -21.30 48 7 LEU A 6 ? ? 62.77 105.31 49 7 PHE A 8 ? ? 48.10 -17.12 50 7 THR A 47 ? ? -144.17 -123.04 51 7 GLU A 48 ? ? -160.93 50.59 52 7 ASP A 73 ? ? -34.97 130.13 53 7 GLU A 76 ? ? 64.46 -30.27 54 7 SER A 78 ? ? -152.26 11.01 55 8 LEU A 6 ? ? 59.51 -18.20 56 8 GLU A 19 ? ? -126.74 -55.91 57 8 GLN A 28 ? ? 73.30 -4.04 58 8 THR A 47 ? ? -140.19 -95.64 59 8 GLU A 48 ? ? -155.07 -26.19 60 8 LEU A 49 ? ? 36.36 126.06 61 8 VAL A 75 ? ? 57.00 -56.02 62 8 GLU A 76 ? ? -148.00 -27.39 63 8 GLU A 77 ? ? -171.37 -49.25 64 8 SER A 78 ? ? -174.50 143.86 65 9 LEU A 6 ? ? -159.48 -40.63 66 9 GLU A 19 ? ? -137.31 -36.50 67 9 GLN A 28 ? ? 56.14 -10.03 68 9 THR A 47 ? ? -141.23 -152.90 69 9 VAL A 75 ? ? 54.67 -58.58 70 9 GLU A 76 ? ? -146.53 -28.50 71 9 GLU A 77 ? ? -161.48 -55.33 72 9 SER A 78 ? ? -166.71 18.35 73 10 LEU A 6 ? ? 60.43 -33.39 74 10 GLU A 19 ? ? -130.99 -61.79 75 10 GLN A 28 ? ? 58.71 -4.99 76 10 THR A 47 ? ? -146.90 -143.75 77 10 GLU A 76 ? ? 61.14 -30.10 78 10 SER A 78 ? ? -144.69 -0.76 79 11 LEU A 6 ? ? 54.19 -10.32 80 11 GLU A 19 ? ? -119.15 -72.33 81 11 GLN A 28 ? ? 57.50 -3.22 82 11 THR A 47 ? ? -152.52 -136.41 83 11 VAL A 75 ? ? 65.84 -48.40 84 11 GLU A 76 ? ? -159.20 -26.06 85 12 LEU A 6 ? ? 56.06 -15.64 86 12 GLU A 19 ? ? -132.70 -54.72 87 12 GLN A 28 ? ? 69.72 -3.82 88 12 THR A 47 ? ? -153.20 -135.22 89 12 LEU A 49 ? ? -55.09 99.57 90 12 LYS A 50 ? ? -47.14 166.24 91 12 ASP A 73 ? ? -51.95 104.11 92 12 VAL A 75 ? ? 57.11 -54.86 93 12 GLU A 76 ? ? -144.87 -30.36 94 12 GLU A 77 ? ? -163.97 -55.31 95 12 SER A 78 ? ? -167.00 14.39 96 13 HIS A 3 ? ? -140.44 12.11 97 13 GLU A 7 ? ? -154.25 23.15 98 13 GLU A 19 ? ? -131.50 -44.35 99 13 GLN A 28 ? ? 59.86 -5.87 100 13 THR A 47 ? ? -147.85 -146.23 101 13 LEU A 49 ? ? -55.47 90.26 102 13 GLU A 76 ? ? 58.06 -22.68 103 13 SER A 78 ? ? -160.25 5.39 104 14 SER A 2 ? ? -152.66 -41.85 105 14 HIS A 3 ? ? -143.52 32.78 106 14 LEU A 6 ? ? -151.03 -30.07 107 14 ILE A 17 ? ? -152.64 3.03 108 14 GLU A 19 ? ? -130.11 -34.24 109 14 GLN A 28 ? ? 58.31 -5.88 110 14 THR A 47 ? ? -143.78 -131.56 111 14 LEU A 49 ? ? 35.05 152.16 112 14 GLU A 76 ? ? -152.30 -44.39 113 14 GLU A 77 ? ? -143.65 -62.63 114 14 SER A 78 ? ? -165.46 9.98 115 15 LEU A 6 ? ? 58.40 3.23 116 15 GLN A 28 ? ? 54.43 -10.69 117 15 THR A 47 ? ? 48.39 105.11 118 15 GLU A 48 ? ? -141.09 28.93 119 15 VAL A 75 ? ? 57.48 -57.02 120 15 GLU A 76 ? ? -145.55 -28.60 121 15 GLU A 77 ? ? -164.01 -54.72 122 15 SER A 78 ? ? -168.55 20.78 123 16 GLU A 19 ? ? -127.49 -59.47 124 16 GLN A 28 ? ? 60.71 -4.69 125 16 THR A 47 ? ? -138.34 -92.55 126 16 GLU A 48 ? ? -160.25 -35.19 127 16 LEU A 49 ? ? 43.95 164.72 128 16 GLU A 74 ? ? 39.48 40.01 129 16 GLU A 76 ? ? 56.72 -34.49 130 17 GLU A 19 ? ? -131.64 -57.95 131 17 GLN A 28 ? ? 56.34 -3.21 132 17 THR A 47 ? ? -148.40 -147.20 133 17 ASP A 72 ? ? 47.12 -13.86 134 17 ASP A 73 ? ? 41.99 -148.77 135 17 GLU A 74 ? ? -179.31 132.34 136 17 VAL A 75 ? ? 56.55 -52.17 137 17 GLU A 76 ? ? -149.54 -34.41 138 17 GLU A 77 ? ? -153.07 -59.43 139 17 SER A 78 ? ? -165.68 23.78 140 18 LEU A 6 ? ? 60.86 -25.14 141 18 GLN A 28 ? ? 59.89 -7.77 142 18 THR A 47 ? ? -129.69 -118.50 143 18 GLU A 48 ? ? -143.14 -26.20 144 18 LEU A 49 ? ? 38.91 -179.52 145 18 GLU A 76 ? ? 62.47 -32.74 146 19 LEU A 6 ? ? -162.38 -38.96 147 19 GLU A 19 ? ? -137.39 -33.04 148 19 GLN A 28 ? ? 76.03 -3.91 149 19 THR A 47 ? ? -147.54 -144.13 150 19 LEU A 49 ? ? -68.17 86.72 151 19 LYS A 50 ? ? -47.32 166.21 152 19 VAL A 75 ? ? 58.08 -56.94 153 19 GLU A 76 ? ? -146.63 -40.19 154 19 GLU A 77 ? ? -156.28 -55.32 155 20 MET A 4 ? ? 55.01 177.33 156 20 LEU A 6 ? ? -152.26 -50.02 157 20 GLU A 7 ? ? -149.44 -52.12 158 20 PHE A 8 ? ? -158.22 -61.13 159 20 GLU A 19 ? ? -135.22 -39.06 160 20 THR A 47 ? ? -146.22 -134.73 161 20 LEU A 49 ? ? -53.10 92.17 162 20 GLU A 76 ? ? 64.00 -16.52 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LYS A 9 ? ? GLN A 10 ? ? -145.99 2 1 ARG A 43 ? ? VAL A 44 ? ? -149.38 3 2 THR A 47 ? ? GLU A 48 ? ? 140.32 4 5 ASP A 73 ? ? GLU A 74 ? ? -148.82 5 8 GLU A 48 ? ? LEU A 49 ? ? -143.49 6 10 THR A 47 ? ? GLU A 48 ? ? -149.57 7 10 ASP A 73 ? ? GLU A 74 ? ? -141.04 8 11 THR A 47 ? ? GLU A 48 ? ? -149.08 9 14 GLU A 48 ? ? LEU A 49 ? ? -149.28 10 15 THR A 47 ? ? GLU A 48 ? ? 136.54 11 16 GLU A 48 ? ? LEU A 49 ? ? -148.61 12 17 ASP A 73 ? ? GLU A 74 ? ? 133.81 13 20 THR A 47 ? ? GLU A 48 ? ? -149.06 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 TYR A 39 ? ? 0.078 'SIDE CHAIN' 2 5 TYR A 13 ? ? 0.067 'SIDE CHAIN' 3 7 PHE A 20 ? ? 0.083 'SIDE CHAIN' 4 8 TYR A 40 ? ? 0.107 'SIDE CHAIN' 5 9 TYR A 13 ? ? 0.066 'SIDE CHAIN' 6 9 TYR A 39 ? ? 0.099 'SIDE CHAIN' 7 10 TYR A 13 ? ? 0.089 'SIDE CHAIN' 8 10 TYR A 39 ? ? 0.065 'SIDE CHAIN' 9 11 TYR A 39 ? ? 0.068 'SIDE CHAIN' 10 14 TYR A 13 ? ? 0.077 'SIDE CHAIN' 11 14 TYR A 39 ? ? 0.077 'SIDE CHAIN' 12 14 TYR A 40 ? ? 0.070 'SIDE CHAIN' 13 15 TYR A 39 ? ? 0.098 'SIDE CHAIN' 14 16 TYR A 39 ? ? 0.066 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JPN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 0.73 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.41 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method 'Amber Modeling Package' # _pdbx_nmr_representative.entry_id 2JPN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1.66 mM [U-99% 13C; U-99% 15N] UvsW.1, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample.component UvsW.1 _pdbx_nmr_exptl_sample.concentration 1.66 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCACB' 1 7 1 '3D C(CO)NH' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HCCH-COSY' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D HCCH-TOCSY' 1 13 1 '2D 1H-15N HSQC, Steady state {1H}-15N NOE' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JPN _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1967 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 669 _pdbx_nmr_constraints.NOE_long_range_total_count 222 _pdbx_nmr_constraints.NOE_medium_range_total_count 578 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 498 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 49 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 49 # _pdbx_nmr_refine.entry_id 2JPN _pdbx_nmr_refine.method 'torsion angle dynamics, molecular dynamics' _pdbx_nmr_refine.details 'ARIA 1.2 was used to calculate 100 structures. AMBER 9 was used to refine 20 low energy structures using GBSA solvation method.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe ? 1 'Accelrys Software Inc.' processing Felix 2000 2 'Accelrys Software Inc.' 'peak picking' Felix 2000 3 'Accelrys Software Inc.' 'chemical shift assignment' Felix 2000 4 ;Linge, O'Donoghue and Nilges ; 'chemical shift assignment' ARIA 1.2 5 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.2 6 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Koll' refinement Amber 9 7 'Laskowski and MacArthur' 'data analysis' ProcheckNMR ? 8 'Cornilescu, Delaglio and Bax' 'restraint generation' TALOS ? 9 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TYR N N N N 284 TYR CA C N S 285 TYR C C N N 286 TYR O O N N 287 TYR CB C N N 288 TYR CG C Y N 289 TYR CD1 C Y N 290 TYR CD2 C Y N 291 TYR CE1 C Y N 292 TYR CE2 C Y N 293 TYR CZ C Y N 294 TYR OH O N N 295 TYR OXT O N N 296 TYR H H N N 297 TYR H2 H N N 298 TYR HA H N N 299 TYR HB2 H N N 300 TYR HB3 H N N 301 TYR HD1 H N N 302 TYR HD2 H N N 303 TYR HE1 H N N 304 TYR HE2 H N N 305 TYR HH H N N 306 TYR HXT H N N 307 VAL N N N N 308 VAL CA C N S 309 VAL C C N N 310 VAL O O N N 311 VAL CB C N N 312 VAL CG1 C N N 313 VAL CG2 C N N 314 VAL OXT O N N 315 VAL H H N N 316 VAL H2 H N N 317 VAL HA H N N 318 VAL HB H N N 319 VAL HG11 H N N 320 VAL HG12 H N N 321 VAL HG13 H N N 322 VAL HG21 H N N 323 VAL HG22 H N N 324 VAL HG23 H N N 325 VAL HXT H N N 326 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 SER N CA sing N N 242 SER N H sing N N 243 SER N H2 sing N N 244 SER CA C sing N N 245 SER CA CB sing N N 246 SER CA HA sing N N 247 SER C O doub N N 248 SER C OXT sing N N 249 SER CB OG sing N N 250 SER CB HB2 sing N N 251 SER CB HB3 sing N N 252 SER OG HG sing N N 253 SER OXT HXT sing N N 254 THR N CA sing N N 255 THR N H sing N N 256 THR N H2 sing N N 257 THR CA C sing N N 258 THR CA CB sing N N 259 THR CA HA sing N N 260 THR C O doub N N 261 THR C OXT sing N N 262 THR CB OG1 sing N N 263 THR CB CG2 sing N N 264 THR CB HB sing N N 265 THR OG1 HG1 sing N N 266 THR CG2 HG21 sing N N 267 THR CG2 HG22 sing N N 268 THR CG2 HG23 sing N N 269 THR OXT HXT sing N N 270 TYR N CA sing N N 271 TYR N H sing N N 272 TYR N H2 sing N N 273 TYR CA C sing N N 274 TYR CA CB sing N N 275 TYR CA HA sing N N 276 TYR C O doub N N 277 TYR C OXT sing N N 278 TYR CB CG sing N N 279 TYR CB HB2 sing N N 280 TYR CB HB3 sing N N 281 TYR CG CD1 doub Y N 282 TYR CG CD2 sing Y N 283 TYR CD1 CE1 sing Y N 284 TYR CD1 HD1 sing N N 285 TYR CD2 CE2 doub Y N 286 TYR CD2 HD2 sing N N 287 TYR CE1 CZ doub Y N 288 TYR CE1 HE1 sing N N 289 TYR CE2 CZ sing Y N 290 TYR CE2 HE2 sing N N 291 TYR CZ OH sing N N 292 TYR OH HH sing N N 293 TYR OXT HXT sing N N 294 VAL N CA sing N N 295 VAL N H sing N N 296 VAL N H2 sing N N 297 VAL CA C sing N N 298 VAL CA CB sing N N 299 VAL CA HA sing N N 300 VAL C O doub N N 301 VAL C OXT sing N N 302 VAL CB CG1 sing N N 303 VAL CB CG2 sing N N 304 VAL CB HB sing N N 305 VAL CG1 HG11 sing N N 306 VAL CG1 HG12 sing N N 307 VAL CG1 HG13 sing N N 308 VAL CG2 HG21 sing N N 309 VAL CG2 HG22 sing N N 310 VAL CG2 HG23 sing N N 311 VAL OXT HXT sing N N 312 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2JPN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_