data_2JQO # _entry.id 2JQO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JQO pdb_00002jqo 10.2210/pdb2jqo/pdb RCSB RCSB100168 ? ? WWPDB D_1000100168 ? ? BMRB 15288 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-03 2 'Structure model' 1 1 2007-09-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-19 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other 9 6 'Structure model' 'Data collection' 10 6 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_database_status 9 6 'Structure model' chem_comp_atom 10 6 'Structure model' chem_comp_bond 11 6 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 6 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JQO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-06 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 15288 . unspecified TargetDB SR547 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cort, J.R.' 1 'Ramelot, T.A.' 2 'Chen, C.X.' 3 'Jang, M.' 4 'Cunningham, K.' 5 'Ma, L.' 6 'Xiao, R.' 7 'Liu, J.' 8 'Baran, M.C.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Kennedy, M.A.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'NMR solution structure of Bacillus subtilis YobA 21-120: Northeast Structural Genomics Consortium target SR547' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Cort, J.R.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein yobA' _entity.formula_weight 12528.110 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 21-120' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVW FHTRKESNPPSATIQKYELLLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVW FHTRKESNPPSATIQKYELLLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SR547 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LYS n 1 4 ASN n 1 5 GLU n 1 6 GLN n 1 7 ASN n 1 8 GLY n 1 9 ASP n 1 10 GLU n 1 11 THR n 1 12 LYS n 1 13 MET n 1 14 GLN n 1 15 SER n 1 16 LEU n 1 17 VAL n 1 18 GLY n 1 19 TYR n 1 20 VAL n 1 21 VAL n 1 22 LEU n 1 23 LYS n 1 24 ASP n 1 25 ASN n 1 26 GLU n 1 27 ARG n 1 28 ALA n 1 29 ILE n 1 30 LEU n 1 31 ILE n 1 32 THR n 1 33 ASP n 1 34 THR n 1 35 LYS n 1 36 ALA n 1 37 PRO n 1 38 GLY n 1 39 LYS n 1 40 GLU n 1 41 ASP n 1 42 TYR n 1 43 ASN n 1 44 LEU n 1 45 SER n 1 46 GLU n 1 47 GLY n 1 48 GLN n 1 49 LEU n 1 50 MET n 1 51 ASN n 1 52 LYS n 1 53 PHE n 1 54 LYS n 1 55 ASN n 1 56 ASN n 1 57 ILE n 1 58 VAL n 1 59 ILE n 1 60 VAL n 1 61 GLY n 1 62 LEU n 1 63 SER n 1 64 GLU n 1 65 ILE n 1 66 ASP n 1 67 ASN n 1 68 THR n 1 69 ASP n 1 70 ASP n 1 71 LEU n 1 72 LYS n 1 73 ARG n 1 74 GLY n 1 75 GLU n 1 76 LYS n 1 77 ILE n 1 78 LYS n 1 79 VAL n 1 80 TRP n 1 81 PHE n 1 82 HIS n 1 83 THR n 1 84 ARG n 1 85 LYS n 1 86 GLU n 1 87 SER n 1 88 ASN n 1 89 PRO n 1 90 PRO n 1 91 SER n 1 92 ALA n 1 93 THR n 1 94 ILE n 1 95 GLN n 1 96 LYS n 1 97 TYR n 1 98 GLU n 1 99 LEU n 1 100 LEU n 1 101 LEU n 1 102 GLU n 1 103 HIS n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene yobA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 HIS 108 108 108 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JQO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JQO _struct.title 'NMR solution structure of Bacillus subtilis YobA 21-120: Northeast Structural Genomics Consortium target SR547' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JQO _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS' _struct_keywords.text ;Protein, OB-fold, beta barrel, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YOBA_BACSU _struct_ref.pdbx_db_accession O31835 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWF HTRKESNPPSATIQKYELL ; _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JQO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O31835 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 100 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JQO MET A 1 ? UNP O31835 ? ? 'expression tag' 1 1 1 2JQO LEU A 101 ? UNP O31835 ? ? 'expression tag' 101 2 1 2JQO GLU A 102 ? UNP O31835 ? ? 'expression tag' 102 3 1 2JQO HIS A 103 ? UNP O31835 ? ? 'expression tag' 103 4 1 2JQO HIS A 104 ? UNP O31835 ? ? 'expression tag' 104 5 1 2JQO HIS A 105 ? UNP O31835 ? ? 'expression tag' 105 6 1 2JQO HIS A 106 ? UNP O31835 ? ? 'expression tag' 106 7 1 2JQO HIS A 107 ? UNP O31835 ? ? 'expression tag' 107 8 1 2JQO HIS A 108 ? UNP O31835 ? ? 'expression tag' 108 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 40 ? LEU A 44 ? GLU A 40 LEU A 44 5 ? 5 HELX_P HELX_P2 2 SER A 45 ? PHE A 53 ? SER A 45 PHE A 53 1 ? 9 HELX_P HELX_P3 3 ASN A 67 ? LEU A 71 ? ASN A 67 LEU A 71 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 1 -1.47 2 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 2 7.80 3 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 3 -0.68 4 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 4 -0.87 5 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 5 1.81 6 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 6 2.39 7 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 7 3.08 8 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 8 0.35 9 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 9 2.29 10 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 10 -0.16 11 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 11 2.18 12 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 12 1.60 13 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 13 3.41 14 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 14 1.36 15 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 15 -0.05 16 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 16 -0.34 17 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 17 3.67 18 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 18 2.91 19 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 19 1.26 20 ASN 88 A . ? ASN 88 A PRO 89 A ? PRO 89 A 20 1.96 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 14 ? LYS A 23 ? GLN A 14 LYS A 23 A 2 ARG A 27 ? ILE A 31 ? ARG A 27 ILE A 31 A 3 ILE A 57 ? GLY A 61 ? ILE A 57 GLY A 61 A 4 SER A 91 ? LEU A 99 ? SER A 91 LEU A 99 A 5 GLU A 75 ? LYS A 85 ? GLU A 75 LYS A 85 A 6 GLN A 14 ? LYS A 23 ? GLN A 14 LYS A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 22 ? N LEU A 22 O ILE A 29 ? O ILE A 29 A 2 3 N LEU A 30 ? N LEU A 30 O VAL A 58 ? O VAL A 58 A 3 4 N GLY A 61 ? N GLY A 61 O ALA A 92 ? O ALA A 92 A 4 5 O GLU A 98 ? O GLU A 98 N LYS A 78 ? N LYS A 78 A 5 6 O ILE A 77 ? O ILE A 77 N GLY A 18 ? N GLY A 18 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 41 ? ? HZ3 A LYS 52 ? ? 1.58 2 2 OD1 A ASP 41 ? ? HZ2 A LYS 52 ? ? 1.57 3 3 OD1 A ASP 41 ? ? HZ1 A LYS 52 ? ? 1.59 4 3 HZ3 A LYS 23 ? ? O A LEU 71 ? ? 1.60 5 4 HE1 A TYR 19 ? ? HA A ASP 33 ? ? 1.30 6 5 OD1 A ASP 41 ? ? HZ2 A LYS 52 ? ? 1.56 7 6 OE2 A GLU 5 ? ? HZ2 A LYS 96 ? ? 1.58 8 6 OD1 A ASP 41 ? ? HZ1 A LYS 52 ? ? 1.60 9 8 OD2 A ASP 41 ? ? HZ3 A LYS 52 ? ? 1.59 10 10 HD22 A LEU 22 ? ? HD12 A ILE 29 ? ? 1.27 11 10 OD2 A ASP 9 ? ? HG1 A THR 11 ? ? 1.57 12 11 OD1 A ASP 41 ? ? HZ1 A LYS 52 ? ? 1.60 13 12 OD2 A ASP 33 ? ? HZ2 A LYS 35 ? ? 1.55 14 12 OD1 A ASP 41 ? ? HZ1 A LYS 52 ? ? 1.59 15 13 HZ1 A LYS 76 ? ? OE1 A GLU 102 ? ? 1.55 16 13 OD2 A ASP 41 ? ? HZ1 A LYS 52 ? ? 1.56 17 14 OD2 A ASP 41 ? ? HZ1 A LYS 52 ? ? 1.55 18 17 OD2 A ASP 41 ? ? HZ2 A LYS 52 ? ? 1.57 19 17 OD1 A ASP 9 ? ? HG1 A THR 11 ? ? 1.59 20 17 H2 A MET 1 ? ? OE2 A GLU 5 ? ? 1.60 21 18 HG2 A GLU 102 ? ? HD2 A HIS 103 ? ? 1.24 22 18 OD2 A ASP 9 ? ? HZ1 A LYS 12 ? ? 1.57 23 19 OD2 A ASP 41 ? ? HZ2 A LYS 52 ? ? 1.58 24 19 OE2 A GLU 75 ? ? HE2 A HIS 103 ? ? 1.60 25 20 OD1 A ASP 41 ? ? HZ1 A LYS 52 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 7 ? ? -174.69 107.26 2 1 ASP A 24 ? ? -115.83 -146.44 3 1 ASN A 56 ? ? -143.57 28.86 4 1 ASN A 67 ? ? -145.30 37.72 5 1 THR A 68 ? ? -69.86 5.01 6 1 HIS A 82 ? ? -155.95 -50.02 7 1 ASN A 88 ? ? 60.73 93.59 8 2 ASN A 2 ? ? -116.86 75.45 9 2 PHE A 53 ? ? -99.03 46.09 10 2 ASN A 67 ? ? -85.55 41.04 11 2 HIS A 82 ? ? -144.79 -42.01 12 2 ASN A 88 ? ? 51.83 90.46 13 3 ASN A 2 ? ? 60.14 77.86 14 3 GLU A 5 ? ? 64.29 -163.18 15 3 PHE A 53 ? ? -91.32 41.34 16 3 LEU A 62 ? ? -88.43 31.57 17 3 THR A 68 ? ? -79.80 32.52 18 3 HIS A 82 ? ? -140.99 -45.06 19 3 GLU A 86 ? ? -90.52 59.49 20 3 ASN A 88 ? ? 68.69 102.06 21 4 ASP A 9 ? ? -99.28 -87.35 22 4 ASN A 25 ? ? 75.08 -55.08 23 4 THR A 34 ? ? -146.97 17.11 24 4 ALA A 36 ? ? 61.58 96.43 25 4 PHE A 53 ? ? -97.40 40.17 26 4 ASN A 88 ? ? 61.09 92.17 27 4 LEU A 101 ? ? 68.92 96.59 28 4 HIS A 104 ? ? 57.68 81.13 29 5 ASN A 4 ? ? 57.79 75.83 30 5 THR A 11 ? ? -65.03 96.97 31 5 ASP A 24 ? ? -123.05 -69.87 32 5 ASN A 25 ? ? -166.09 -75.24 33 5 ASP A 33 ? ? -163.58 -162.73 34 5 THR A 34 ? ? 82.15 23.07 35 5 ALA A 36 ? ? 70.63 134.36 36 5 PHE A 53 ? ? -98.81 44.65 37 5 ASN A 88 ? ? 57.98 90.96 38 5 HIS A 107 ? ? -118.36 -76.65 39 6 ASN A 88 ? ? 60.31 89.99 40 7 ASP A 9 ? ? -69.25 95.39 41 7 GLU A 10 ? ? -163.01 -50.61 42 7 ASP A 24 ? ? -88.42 -73.69 43 7 ASN A 25 ? ? 171.73 -64.13 44 7 ALA A 36 ? ? 64.34 107.45 45 7 PHE A 53 ? ? -118.58 55.58 46 7 THR A 68 ? ? -97.29 35.30 47 7 HIS A 82 ? ? -152.37 -37.70 48 7 ASN A 88 ? ? 42.92 100.08 49 7 GLU A 102 ? ? -67.35 -175.80 50 7 HIS A 107 ? ? -160.71 -87.36 51 8 ASP A 24 ? ? -92.77 -66.77 52 8 ASN A 25 ? ? 160.90 -51.45 53 8 THR A 34 ? ? -63.88 90.69 54 8 PHE A 53 ? ? -108.65 46.86 55 8 ASN A 55 ? ? 69.19 -5.52 56 8 LEU A 62 ? ? -87.55 43.13 57 8 ASN A 88 ? ? 59.37 102.08 58 9 GLN A 6 ? ? -171.34 -66.25 59 9 ASN A 7 ? ? -91.38 41.89 60 9 ASP A 9 ? ? -112.89 -164.03 61 9 ASP A 33 ? ? 65.22 93.24 62 9 ALA A 36 ? ? 65.43 102.98 63 9 PHE A 53 ? ? -106.04 44.08 64 9 ASN A 55 ? ? 76.37 -40.96 65 9 ASN A 88 ? ? 66.30 101.72 66 9 HIS A 106 ? ? -121.36 -90.71 67 9 HIS A 107 ? ? -147.99 -51.85 68 10 ASN A 7 ? ? 60.25 92.58 69 10 VAL A 21 ? ? -107.23 -63.19 70 10 ASP A 24 ? ? -106.27 -158.08 71 10 ASP A 33 ? ? 54.05 75.49 72 10 ALA A 36 ? ? 70.98 112.57 73 10 ASN A 67 ? ? -157.77 81.58 74 10 ASN A 88 ? ? 66.68 95.06 75 11 LYS A 3 ? ? -111.62 -164.67 76 11 GLN A 6 ? ? -105.25 -72.06 77 11 ASN A 7 ? ? 174.64 -48.95 78 11 HIS A 82 ? ? -130.34 -60.84 79 11 GLU A 86 ? ? -92.60 42.52 80 11 ASN A 88 ? ? 64.39 102.38 81 12 PHE A 53 ? ? -113.59 55.39 82 12 ASN A 67 ? ? -81.01 47.99 83 12 GLU A 86 ? ? -110.02 56.50 84 12 ASN A 88 ? ? 63.87 99.78 85 13 ASP A 24 ? ? -123.14 -155.72 86 13 ASP A 33 ? ? 60.82 -162.43 87 13 LYS A 35 ? ? 62.96 -174.62 88 13 PHE A 53 ? ? -102.55 40.07 89 13 ASN A 67 ? ? -153.94 83.77 90 13 HIS A 82 ? ? -147.27 -35.80 91 13 ASN A 88 ? ? 65.65 99.51 92 14 ASN A 7 ? ? -55.92 108.17 93 14 ASP A 24 ? ? -83.78 -70.41 94 14 ASN A 25 ? ? -154.68 -60.59 95 14 ASP A 33 ? ? 64.28 101.77 96 14 ALA A 36 ? ? 65.25 102.84 97 14 THR A 68 ? ? -80.43 37.73 98 14 HIS A 82 ? ? -164.57 -35.33 99 14 ASN A 88 ? ? 62.01 96.18 100 14 LEU A 101 ? ? -66.49 93.33 101 14 HIS A 104 ? ? -128.67 -58.54 102 14 HIS A 105 ? ? 61.21 -166.40 103 15 ASP A 33 ? ? 55.50 86.91 104 15 THR A 34 ? ? -148.44 31.63 105 15 ALA A 36 ? ? 62.44 150.90 106 15 PHE A 53 ? ? -95.35 46.39 107 15 ASN A 67 ? ? -89.81 33.50 108 16 ASN A 56 ? ? -154.49 34.44 109 16 ASP A 66 ? ? 76.08 -37.98 110 16 ASN A 88 ? ? 60.18 101.11 111 17 ASN A 2 ? ? -114.52 -165.68 112 17 ASN A 25 ? ? 75.63 -55.59 113 17 PHE A 53 ? ? -100.58 47.12 114 17 THR A 83 ? ? -172.29 148.22 115 17 GLU A 86 ? ? -84.25 47.47 116 17 ASN A 88 ? ? 55.57 93.95 117 18 GLU A 10 ? ? -107.30 -71.46 118 18 ASN A 25 ? ? 163.72 -60.08 119 18 PHE A 53 ? ? -96.23 49.64 120 18 THR A 68 ? ? -86.45 44.13 121 18 GLU A 75 ? ? -119.08 -168.01 122 18 ASN A 88 ? ? 58.12 92.72 123 18 LYS A 96 ? ? -172.27 147.60 124 18 GLU A 102 ? ? -141.83 -78.74 125 19 ASN A 2 ? ? 67.37 176.06 126 19 LYS A 3 ? ? -175.76 -53.55 127 19 ASP A 9 ? ? -172.15 -37.00 128 19 ASP A 24 ? ? -104.26 -80.68 129 19 ASN A 25 ? ? -144.40 -66.57 130 19 PRO A 37 ? ? -54.77 -71.63 131 19 PHE A 53 ? ? -96.10 37.09 132 19 ASN A 67 ? ? -97.57 37.43 133 19 ASN A 88 ? ? 63.43 97.30 134 20 ASP A 24 ? ? -111.82 -165.19 135 20 ASN A 55 ? ? 73.84 -7.47 136 20 ASN A 67 ? ? -80.70 43.99 137 20 HIS A 82 ? ? -142.54 -38.72 138 20 ASN A 88 ? ? 60.77 99.09 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'lowest energy, fewest restraint violations, favorable non-bonded parameters' _pdbx_nmr_ensemble.conformers_calculated_total_number 25 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JQO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JQO _pdbx_nmr_representative.selection_criteria 'no selection bias was used' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.75 mM [U-100% 13C; U-100% 15N] entity, 10 mM dithiothreitol, 5 mM calcium chloride, 100 mM sodium chloride, 20 mM ammonium acetate, 0.02 % sodium azide, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;0.79 mM [U-100% N15]; 13C from 5% 13C-glucose in growth medium entity, 10 mM dithiothreitol, 5 mM calcium chloride, 100 mM sodium chloride, 20 mM ammonium acetate, 0.02 % sodium azide, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' ;0.75 mM [U-100% 13C; U-100% 15N] entity, 10 mM dithiothreitol, 5 mM calcium chloride, 100 mM sodium chloride, 20 mM ammonium acetate, 0.02 % sodium azide, 100% D2O ; 3 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity 0.75 mM '[U-100% 13C; U-100% 15N]' 1 dithiothreitol 10 mM ? 1 'calcium chloride' 5 mM ? 1 'sodium chloride' 100 mM ? 1 'ammonium acetate' 20 mM ? 1 'sodium azide' 0.02 % ? 1 entity 0.79 mM '[U-100% N15]; 13C from 5% 13C-glucose in growth medium' 2 dithiothreitol 10 mM ? 2 'calcium chloride' 5 mM ? 2 'sodium chloride' 100 mM ? 2 'ammonium acetate' 20 mM ? 2 'sodium azide' 0.02 % ? 2 entity 0.75 mM '[U-100% 13C; U-100% 15N]' 3 dithiothreitol 10 mM ? 3 'calcium chloride' 5 mM ? 3 'sodium chloride' 100 mM ? 3 'ammonium acetate' 20 mM ? 3 'sodium azide' 0.02 % ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D HNHA' 1 8 1 '3D HNCO' 1 9 1 '3D CCH-TOCSY' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY' 1 12 3 '4D 1H-13C-13C-1H HMQC-NOESY' # _pdbx_nmr_refine.entry_id 2JQO _pdbx_nmr_refine.method 'torsion angle dynamics, molecular dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure ? 1 Goddard 'data analysis' Sparky ? 2 'Accelrys Software Inc.' processing Felix ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 'Bhattacharya and Montelione' 'structure evaluation' PSVS ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2JQO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_