data_2JVD # _entry.id 2JVD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JVD pdb_00002jvd 10.2210/pdb2jvd/pdb RCSB RCSB100337 ? ? WWPDB D_1000100337 ? ? BMRB 15476 ? 10.13018/BMR15476 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_database_status 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JVD _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-09-18 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.content_type SR384 TargetDB . unspecified 15476 BMRB . unspecified 2HEP PDB 'Solution NMR structure of full length protein ynzC' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Aramini, J.M.' 1 'Sharma, S.' 2 'Huang, Y.J.' 3 'Zhao, L.' 4 'Owens, L.A.' 5 'Stokes, K.' 6 'Jiang, M.' 7 'Xiao, R.' 8 'Baran, M.C.' 9 'Swapna, G.V.T.' 10 'Acton, T.B.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Solution NMR structure of the SOS response protein YnzC from Bacillus subtilis.' _citation.journal_abbrev Proteins _citation.journal_volume 72 _citation.page_first 526 _citation.page_last 530 _citation.year 2008 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18431750 _citation.pdbx_database_id_DOI 10.1002/prot.22064 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aramini, J.M.' 1 ? primary 'Sharma, S.' 2 ? primary 'Huang, Y.J.' 3 ? primary 'Swapna, G.V.' 4 ? primary 'Ho, C.K.' 5 ? primary 'Shetty, K.' 6 ? primary 'Cunningham, K.' 7 ? primary 'Ma, L.C.' 8 ? primary 'Zhao, L.' 9 ? primary 'Owens, L.A.' 10 ? primary 'Jiang, M.' 11 ? primary 'Xiao, R.' 12 ? primary 'Liu, J.' 13 ? primary 'Baran, M.C.' 14 ? primary 'Acton, T.B.' 15 ? primary 'Rost, B.' 16 ? primary 'Montelione, G.T.' 17 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UPF0291 protein ynzC' _entity.formula_weight 6290.241 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Residues 1-46' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SR384 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 SER n 1 4 ASN n 1 5 ALA n 1 6 LYS n 1 7 ILE n 1 8 ALA n 1 9 ARG n 1 10 ILE n 1 11 ASN n 1 12 GLU n 1 13 LEU n 1 14 ALA n 1 15 ALA n 1 16 LYS n 1 17 ALA n 1 18 LYS n 1 19 ALA n 1 20 GLY n 1 21 VAL n 1 22 ILE n 1 23 THR n 1 24 GLU n 1 25 GLU n 1 26 GLU n 1 27 LYS n 1 28 ALA n 1 29 GLU n 1 30 GLN n 1 31 GLN n 1 32 LYS n 1 33 LEU n 1 34 ARG n 1 35 GLN n 1 36 GLU n 1 37 TYR n 1 38 LEU n 1 39 LYS n 1 40 GLY n 1 41 PHE n 1 42 ARG n 1 43 SER n 1 44 SER n 1 45 MET n 1 46 LYS n 1 47 LEU n 1 48 GLU n 1 49 HIS n 1 50 HIS n 1 51 HIS n 1 52 HIS n 1 53 HIS n 1 54 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene 'ynzC, BSU17880' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)MGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector SR384-1-46-21.1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 HIS 49 49 ? ? ? A . n A 1 50 HIS 50 50 ? ? ? A . n A 1 51 HIS 51 51 ? ? ? A . n A 1 52 HIS 52 52 ? ? ? A . n A 1 53 HIS 53 53 ? ? ? A . n A 1 54 HIS 54 54 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JVD _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JVD _struct.title ;Solution NMR structure of the folded N-terminal fragment of UPF0291 protein ynzC from Bacillus subtilis. Northeast Structural Genomics target SR384-1-46 ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JVD _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;solution NMR structure, construct optimization, Cytoplasm, STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YNZC_BACSU _struct_ref.pdbx_db_accession O31818 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMK _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JVD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O31818 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 46 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JVD LEU A 47 ? UNP O31818 ? ? 'expression tag' 47 1 1 2JVD GLU A 48 ? UNP O31818 ? ? 'expression tag' 48 2 1 2JVD HIS A 49 ? UNP O31818 ? ? 'expression tag' 49 3 1 2JVD HIS A 50 ? UNP O31818 ? ? 'expression tag' 50 4 1 2JVD HIS A 51 ? UNP O31818 ? ? 'expression tag' 51 5 1 2JVD HIS A 52 ? UNP O31818 ? ? 'expression tag' 52 6 1 2JVD HIS A 53 ? UNP O31818 ? ? 'expression tag' 53 7 1 2JVD HIS A 54 ? UNP O31818 ? ? 'expression tag' 54 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? GLY A 20 ? SER A 3 GLY A 20 1 ? 18 HELX_P HELX_P2 2 THR A 23 ? LYS A 39 ? THR A 23 LYS A 39 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 39 ? ? -50.07 99.65 2 3 LYS A 39 ? ? -60.63 90.65 3 4 LYS A 39 ? ? -63.07 90.44 4 4 LEU A 47 ? ? -164.26 16.45 5 5 SER A 44 ? ? 57.21 11.43 6 5 LYS A 46 ? ? 57.94 89.79 7 7 LYS A 39 ? ? -58.02 100.72 8 8 LYS A 39 ? ? -58.52 91.85 9 9 SER A 43 ? ? 61.62 -73.55 10 9 SER A 44 ? ? 40.78 28.79 11 10 LEU A 38 ? ? -81.27 -78.10 12 10 LEU A 47 ? ? 76.05 -16.12 13 11 LYS A 39 ? ? -56.53 106.85 14 12 LYS A 39 ? ? -57.74 95.78 15 13 LYS A 39 ? ? 61.23 86.37 16 13 ARG A 42 ? ? 72.06 -56.97 17 13 SER A 44 ? ? 59.42 18.61 18 13 LYS A 46 ? ? -84.88 42.62 19 15 LYS A 39 ? ? -64.18 96.29 20 15 ARG A 42 ? ? -59.79 -4.87 21 16 LYS A 39 ? ? -56.39 92.42 22 17 LYS A 39 ? ? -60.14 91.22 23 17 LYS A 46 ? ? 60.67 91.89 24 17 LEU A 47 ? ? -173.70 107.42 25 18 LYS A 39 ? ? -57.97 99.51 26 18 SER A 43 ? ? 70.40 -48.53 27 18 SER A 44 ? ? -69.29 97.95 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.00 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JVD _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 0.0 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.31 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method PDBStat # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.00 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2JVD _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JVD _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.36 mM [U-100% 13C; U-100% 15N] SR384-1-46, 20 mM MES, 100 mM sodium chloride, 10 mM DTT, 5 mM calcium chloride, 0.02 % sodium azide, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;1.1 mM [U-5% 13C; U-100% 15N] SR384-1-46, 20 mM MES, 100 mM sodium chloride, 10 mM DTT, 5 mM calcium chloride, 0.02 % sodium azide, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id SR384-1-46 1.36 mM '[U-100% 13C; U-100% 15N]' 1 MES 20 mM ? 1 'sodium chloride' 100 mM ? 1 DTT 10 mM ? 1 'calcium chloride' 5 mM ? 1 'sodium azide' 0.02 % ? 1 SR384-1-46 1.1 mM '[U-5% 13C; U-100% 15N]' 2 MES 20 mM ? 2 'sodium chloride' 100 mM ? 2 DTT 10 mM ? 2 'calcium chloride' 5 mM ? 2 'sodium azide' 0.02 % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HN(CA)CO' 1 5 1 '3D HNCACB' 1 6 1 '3D HN(COCA)CB' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D HCCH-COSY' 1 9 1 '3D CCH-TOCSY' 1 10 1 '3D simultaneous CN-NOESY' 1 11 1 '3D HNHA' 1 12 2 '2D 1H-13C HSQC stereospecific Leu/Val methyl' # _pdbx_nmr_details.entry_id 2JVD _pdbx_nmr_details.text ;THE PROTEIN IS MONOMERIC BY STATIC LIGHT SCATTERING. THE STRUCTURE WAS DETERMINED USING TRIPLE RESONANCE NMR SPECTROSCOPY. AUTOMATED BACKBONE ASSIGNMENTS WERE MADE USING AUTOASSIGN, AND THE SIDE CHAIN ASSIGNMENTS WERE COMPLETED MANUALLY. AUTOMATIC NOESY ASSIGNMENTS WERE DETERMINED USING CYANA 2.1. DIHEDRAL ANGLE CONSTRAINTS WERE OBTAINED FROM TALOS. HYDROGEN BOND CONSTRAINTS WERE DETERMINED USING BOTH AUTOSTRUCTURE AND CYANA, AND WERE APPLIED ONLY IN THE FINAL REFINEMENT STAGE (CNS) OF THE STRUCTURE DETERMINATION. COMPLETENESS OF NMR ASSIGNMENTS (EXCLUDING C-TERMINAL HHHHHH): BACKBONE, 98.8%, SIDE CHAIN, 96.9%, AROMATICS, 100%, STEREOSPECIFIC METHYL, 100%, STEREOSPECIFIC SIDE CHAIN NH2: 100%. FINAL STRUCTURE QUALITY FACTORS (FOR RESIDUES 1 TO 48, PSVS 1.3), WHERE ORDERED RESIDUES [S(PHI) + S(PSI) > 1.8] COMPRISE: 2-38: (A) RMSD (ORDERED RESIDUES): BB, 0.4, HEAVY ATOM, 0.9. (B) RAMACHANDRAN STATISTICS FOR ORDERED RESIDUES: MOST FAVORED, 98.6%, ADDITIONALLY ALLOWED, 1.4%, GENEROUSLY ALLOWED, 0.0%, DISALLOWED, 0.0%. (C) PROCHECK SCORES FOR ORDERED RESIDUES (RAW/Z-): PHI-PSI, 0.53/2.40, ALL, 0.50/2.96. (D) MOLPROBITY CLASH SCORE (RAW/Z-): 15.44/-1.12. (E) RPF SCORES FOR GOODNESS OF FIT TO NOESY DATA (RESIDUES 1-48): RECALL, 0.988, PRECISION, 0.944, F-MEASURE, 0.966, DP-SCORE, 0.822. (F) NUMBER OF CLOSE CONTACTS PER 20 MODELS: NONE. THE C- TERMINAL HIS TAG RESIDUES OF THE PROTEIN (HHHHHH) WERE NOT INCLUDED IN THE STRUCTURE CALCULATIONS AND HAVE BEEN OMITTED FROM THIS DEPOSITION. COORDINATES FOR THE FOLLOWING RESIDUES ARE NOT WELL DETERMINED [S(PHI) + S(PSI) < 1.8]: 1,39-48. ; # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JVD _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1040 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 328 _pdbx_nmr_constraints.NOE_long_range_total_count 196 _pdbx_nmr_constraints.NOE_medium_range_total_count 315 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 201 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 66 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 66 # _pdbx_nmr_refine.entry_id 2JVD _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THE FINAL STRUCTURES ARE BASED ON A TOTAL OF 1022 CONFORMATIONALLY-RESTRICTING NOE-DERIVED DISTANCE CONSTRAINTS, 68 DIHEDRAL ANGLE CONSTRAINTS, AND 48 HYDROGEN BOND CONSTRAINTS (25.9 CONSTRAINTS PER RESIDUE, 4.4 LONG RANGE CONSTRAINTS PER RESIDUE, COMPUTED FOR RESIDUES 1 TO 48 BY PSVS 1.3). STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA 2.1. THE 20 STRUCTURES OUT OF 100 WITH THE LOWEST TARGET FUNCTION WERE FURTHER REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS) WITH PARAM19. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 1.3 1 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.4.0 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.3 4 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1.1 5 'Huang, Tejero, Powers and Montelione' 'rpf calculation' AutoStructure 2.1.1 6 'Bhattacharya and Montelione' 'structure validation' PSVS 1.3 7 'Tejero and Montelione' 'pdb analysis' PdbStat 5.0 8 'Laskowski, MacArthur, Smith, Jones, Hutchinson, Morris, Moss' 'structure validation' Procheck ? 9 Richardson 'structure validation' MolProbity ? 10 Goddard 'peak picking' Sparky 3.110 11 Goddard 'data analysis' Sparky 3.110 12 Varian collection VNMR 6.1C 13 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 14 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 49 ? A HIS 49 2 1 Y 1 A HIS 50 ? A HIS 50 3 1 Y 1 A HIS 51 ? A HIS 51 4 1 Y 1 A HIS 52 ? A HIS 52 5 1 Y 1 A HIS 53 ? A HIS 53 6 1 Y 1 A HIS 54 ? A HIS 54 7 2 Y 1 A HIS 49 ? A HIS 49 8 2 Y 1 A HIS 50 ? A HIS 50 9 2 Y 1 A HIS 51 ? A HIS 51 10 2 Y 1 A HIS 52 ? A HIS 52 11 2 Y 1 A HIS 53 ? A HIS 53 12 2 Y 1 A HIS 54 ? A HIS 54 13 3 Y 1 A HIS 49 ? A HIS 49 14 3 Y 1 A HIS 50 ? A HIS 50 15 3 Y 1 A HIS 51 ? A HIS 51 16 3 Y 1 A HIS 52 ? A HIS 52 17 3 Y 1 A HIS 53 ? A HIS 53 18 3 Y 1 A HIS 54 ? A HIS 54 19 4 Y 1 A HIS 49 ? A HIS 49 20 4 Y 1 A HIS 50 ? A HIS 50 21 4 Y 1 A HIS 51 ? A HIS 51 22 4 Y 1 A HIS 52 ? A HIS 52 23 4 Y 1 A HIS 53 ? A HIS 53 24 4 Y 1 A HIS 54 ? A HIS 54 25 5 Y 1 A HIS 49 ? A HIS 49 26 5 Y 1 A HIS 50 ? A HIS 50 27 5 Y 1 A HIS 51 ? A HIS 51 28 5 Y 1 A HIS 52 ? A HIS 52 29 5 Y 1 A HIS 53 ? A HIS 53 30 5 Y 1 A HIS 54 ? A HIS 54 31 6 Y 1 A HIS 49 ? A HIS 49 32 6 Y 1 A HIS 50 ? A HIS 50 33 6 Y 1 A HIS 51 ? A HIS 51 34 6 Y 1 A HIS 52 ? A HIS 52 35 6 Y 1 A HIS 53 ? A HIS 53 36 6 Y 1 A HIS 54 ? A HIS 54 37 7 Y 1 A HIS 49 ? A HIS 49 38 7 Y 1 A HIS 50 ? A HIS 50 39 7 Y 1 A HIS 51 ? A HIS 51 40 7 Y 1 A HIS 52 ? A HIS 52 41 7 Y 1 A HIS 53 ? A HIS 53 42 7 Y 1 A HIS 54 ? A HIS 54 43 8 Y 1 A HIS 49 ? A HIS 49 44 8 Y 1 A HIS 50 ? A HIS 50 45 8 Y 1 A HIS 51 ? A HIS 51 46 8 Y 1 A HIS 52 ? A HIS 52 47 8 Y 1 A HIS 53 ? A HIS 53 48 8 Y 1 A HIS 54 ? A HIS 54 49 9 Y 1 A HIS 49 ? A HIS 49 50 9 Y 1 A HIS 50 ? A HIS 50 51 9 Y 1 A HIS 51 ? A HIS 51 52 9 Y 1 A HIS 52 ? A HIS 52 53 9 Y 1 A HIS 53 ? A HIS 53 54 9 Y 1 A HIS 54 ? A HIS 54 55 10 Y 1 A HIS 49 ? A HIS 49 56 10 Y 1 A HIS 50 ? A HIS 50 57 10 Y 1 A HIS 51 ? A HIS 51 58 10 Y 1 A HIS 52 ? A HIS 52 59 10 Y 1 A HIS 53 ? A HIS 53 60 10 Y 1 A HIS 54 ? A HIS 54 61 11 Y 1 A HIS 49 ? A HIS 49 62 11 Y 1 A HIS 50 ? A HIS 50 63 11 Y 1 A HIS 51 ? A HIS 51 64 11 Y 1 A HIS 52 ? A HIS 52 65 11 Y 1 A HIS 53 ? A HIS 53 66 11 Y 1 A HIS 54 ? A HIS 54 67 12 Y 1 A HIS 49 ? A HIS 49 68 12 Y 1 A HIS 50 ? A HIS 50 69 12 Y 1 A HIS 51 ? A HIS 51 70 12 Y 1 A HIS 52 ? A HIS 52 71 12 Y 1 A HIS 53 ? A HIS 53 72 12 Y 1 A HIS 54 ? A HIS 54 73 13 Y 1 A HIS 49 ? A HIS 49 74 13 Y 1 A HIS 50 ? A HIS 50 75 13 Y 1 A HIS 51 ? A HIS 51 76 13 Y 1 A HIS 52 ? A HIS 52 77 13 Y 1 A HIS 53 ? A HIS 53 78 13 Y 1 A HIS 54 ? A HIS 54 79 14 Y 1 A HIS 49 ? A HIS 49 80 14 Y 1 A HIS 50 ? A HIS 50 81 14 Y 1 A HIS 51 ? A HIS 51 82 14 Y 1 A HIS 52 ? A HIS 52 83 14 Y 1 A HIS 53 ? A HIS 53 84 14 Y 1 A HIS 54 ? A HIS 54 85 15 Y 1 A HIS 49 ? A HIS 49 86 15 Y 1 A HIS 50 ? A HIS 50 87 15 Y 1 A HIS 51 ? A HIS 51 88 15 Y 1 A HIS 52 ? A HIS 52 89 15 Y 1 A HIS 53 ? A HIS 53 90 15 Y 1 A HIS 54 ? A HIS 54 91 16 Y 1 A HIS 49 ? A HIS 49 92 16 Y 1 A HIS 50 ? A HIS 50 93 16 Y 1 A HIS 51 ? A HIS 51 94 16 Y 1 A HIS 52 ? A HIS 52 95 16 Y 1 A HIS 53 ? A HIS 53 96 16 Y 1 A HIS 54 ? A HIS 54 97 17 Y 1 A HIS 49 ? A HIS 49 98 17 Y 1 A HIS 50 ? A HIS 50 99 17 Y 1 A HIS 51 ? A HIS 51 100 17 Y 1 A HIS 52 ? A HIS 52 101 17 Y 1 A HIS 53 ? A HIS 53 102 17 Y 1 A HIS 54 ? A HIS 54 103 18 Y 1 A HIS 49 ? A HIS 49 104 18 Y 1 A HIS 50 ? A HIS 50 105 18 Y 1 A HIS 51 ? A HIS 51 106 18 Y 1 A HIS 52 ? A HIS 52 107 18 Y 1 A HIS 53 ? A HIS 53 108 18 Y 1 A HIS 54 ? A HIS 54 109 19 Y 1 A HIS 49 ? A HIS 49 110 19 Y 1 A HIS 50 ? A HIS 50 111 19 Y 1 A HIS 51 ? A HIS 51 112 19 Y 1 A HIS 52 ? A HIS 52 113 19 Y 1 A HIS 53 ? A HIS 53 114 19 Y 1 A HIS 54 ? A HIS 54 115 20 Y 1 A HIS 49 ? A HIS 49 116 20 Y 1 A HIS 50 ? A HIS 50 117 20 Y 1 A HIS 51 ? A HIS 51 118 20 Y 1 A HIS 52 ? A HIS 52 119 20 Y 1 A HIS 53 ? A HIS 53 120 20 Y 1 A HIS 54 ? A HIS 54 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 HIS N N N N 107 HIS CA C N S 108 HIS C C N N 109 HIS O O N N 110 HIS CB C N N 111 HIS CG C Y N 112 HIS ND1 N Y N 113 HIS CD2 C Y N 114 HIS CE1 C Y N 115 HIS NE2 N Y N 116 HIS OXT O N N 117 HIS H H N N 118 HIS H2 H N N 119 HIS HA H N N 120 HIS HB2 H N N 121 HIS HB3 H N N 122 HIS HD1 H N N 123 HIS HD2 H N N 124 HIS HE1 H N N 125 HIS HE2 H N N 126 HIS HXT H N N 127 ILE N N N N 128 ILE CA C N S 129 ILE C C N N 130 ILE O O N N 131 ILE CB C N S 132 ILE CG1 C N N 133 ILE CG2 C N N 134 ILE CD1 C N N 135 ILE OXT O N N 136 ILE H H N N 137 ILE H2 H N N 138 ILE HA H N N 139 ILE HB H N N 140 ILE HG12 H N N 141 ILE HG13 H N N 142 ILE HG21 H N N 143 ILE HG22 H N N 144 ILE HG23 H N N 145 ILE HD11 H N N 146 ILE HD12 H N N 147 ILE HD13 H N N 148 ILE HXT H N N 149 LEU N N N N 150 LEU CA C N S 151 LEU C C N N 152 LEU O O N N 153 LEU CB C N N 154 LEU CG C N N 155 LEU CD1 C N N 156 LEU CD2 C N N 157 LEU OXT O N N 158 LEU H H N N 159 LEU H2 H N N 160 LEU HA H N N 161 LEU HB2 H N N 162 LEU HB3 H N N 163 LEU HG H N N 164 LEU HD11 H N N 165 LEU HD12 H N N 166 LEU HD13 H N N 167 LEU HD21 H N N 168 LEU HD22 H N N 169 LEU HD23 H N N 170 LEU HXT H N N 171 LYS N N N N 172 LYS CA C N S 173 LYS C C N N 174 LYS O O N N 175 LYS CB C N N 176 LYS CG C N N 177 LYS CD C N N 178 LYS CE C N N 179 LYS NZ N N N 180 LYS OXT O N N 181 LYS H H N N 182 LYS H2 H N N 183 LYS HA H N N 184 LYS HB2 H N N 185 LYS HB3 H N N 186 LYS HG2 H N N 187 LYS HG3 H N N 188 LYS HD2 H N N 189 LYS HD3 H N N 190 LYS HE2 H N N 191 LYS HE3 H N N 192 LYS HZ1 H N N 193 LYS HZ2 H N N 194 LYS HZ3 H N N 195 LYS HXT H N N 196 MET N N N N 197 MET CA C N S 198 MET C C N N 199 MET O O N N 200 MET CB C N N 201 MET CG C N N 202 MET SD S N N 203 MET CE C N N 204 MET OXT O N N 205 MET H H N N 206 MET H2 H N N 207 MET HA H N N 208 MET HB2 H N N 209 MET HB3 H N N 210 MET HG2 H N N 211 MET HG3 H N N 212 MET HE1 H N N 213 MET HE2 H N N 214 MET HE3 H N N 215 MET HXT H N N 216 PHE N N N N 217 PHE CA C N S 218 PHE C C N N 219 PHE O O N N 220 PHE CB C N N 221 PHE CG C Y N 222 PHE CD1 C Y N 223 PHE CD2 C Y N 224 PHE CE1 C Y N 225 PHE CE2 C Y N 226 PHE CZ C Y N 227 PHE OXT O N N 228 PHE H H N N 229 PHE H2 H N N 230 PHE HA H N N 231 PHE HB2 H N N 232 PHE HB3 H N N 233 PHE HD1 H N N 234 PHE HD2 H N N 235 PHE HE1 H N N 236 PHE HE2 H N N 237 PHE HZ H N N 238 PHE HXT H N N 239 SER N N N N 240 SER CA C N S 241 SER C C N N 242 SER O O N N 243 SER CB C N N 244 SER OG O N N 245 SER OXT O N N 246 SER H H N N 247 SER H2 H N N 248 SER HA H N N 249 SER HB2 H N N 250 SER HB3 H N N 251 SER HG H N N 252 SER HXT H N N 253 THR N N N N 254 THR CA C N S 255 THR C C N N 256 THR O O N N 257 THR CB C N R 258 THR OG1 O N N 259 THR CG2 C N N 260 THR OXT O N N 261 THR H H N N 262 THR H2 H N N 263 THR HA H N N 264 THR HB H N N 265 THR HG1 H N N 266 THR HG21 H N N 267 THR HG22 H N N 268 THR HG23 H N N 269 THR HXT H N N 270 TYR N N N N 271 TYR CA C N S 272 TYR C C N N 273 TYR O O N N 274 TYR CB C N N 275 TYR CG C Y N 276 TYR CD1 C Y N 277 TYR CD2 C Y N 278 TYR CE1 C Y N 279 TYR CE2 C Y N 280 TYR CZ C Y N 281 TYR OH O N N 282 TYR OXT O N N 283 TYR H H N N 284 TYR H2 H N N 285 TYR HA H N N 286 TYR HB2 H N N 287 TYR HB3 H N N 288 TYR HD1 H N N 289 TYR HD2 H N N 290 TYR HE1 H N N 291 TYR HE2 H N N 292 TYR HH H N N 293 TYR HXT H N N 294 VAL N N N N 295 VAL CA C N S 296 VAL C C N N 297 VAL O O N N 298 VAL CB C N N 299 VAL CG1 C N N 300 VAL CG2 C N N 301 VAL OXT O N N 302 VAL H H N N 303 VAL H2 H N N 304 VAL HA H N N 305 VAL HB H N N 306 VAL HG11 H N N 307 VAL HG12 H N N 308 VAL HG13 H N N 309 VAL HG21 H N N 310 VAL HG22 H N N 311 VAL HG23 H N N 312 VAL HXT H N N 313 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 HIS N CA sing N N 101 HIS N H sing N N 102 HIS N H2 sing N N 103 HIS CA C sing N N 104 HIS CA CB sing N N 105 HIS CA HA sing N N 106 HIS C O doub N N 107 HIS C OXT sing N N 108 HIS CB CG sing N N 109 HIS CB HB2 sing N N 110 HIS CB HB3 sing N N 111 HIS CG ND1 sing Y N 112 HIS CG CD2 doub Y N 113 HIS ND1 CE1 doub Y N 114 HIS ND1 HD1 sing N N 115 HIS CD2 NE2 sing Y N 116 HIS CD2 HD2 sing N N 117 HIS CE1 NE2 sing Y N 118 HIS CE1 HE1 sing N N 119 HIS NE2 HE2 sing N N 120 HIS OXT HXT sing N N 121 ILE N CA sing N N 122 ILE N H sing N N 123 ILE N H2 sing N N 124 ILE CA C sing N N 125 ILE CA CB sing N N 126 ILE CA HA sing N N 127 ILE C O doub N N 128 ILE C OXT sing N N 129 ILE CB CG1 sing N N 130 ILE CB CG2 sing N N 131 ILE CB HB sing N N 132 ILE CG1 CD1 sing N N 133 ILE CG1 HG12 sing N N 134 ILE CG1 HG13 sing N N 135 ILE CG2 HG21 sing N N 136 ILE CG2 HG22 sing N N 137 ILE CG2 HG23 sing N N 138 ILE CD1 HD11 sing N N 139 ILE CD1 HD12 sing N N 140 ILE CD1 HD13 sing N N 141 ILE OXT HXT sing N N 142 LEU N CA sing N N 143 LEU N H sing N N 144 LEU N H2 sing N N 145 LEU CA C sing N N 146 LEU CA CB sing N N 147 LEU CA HA sing N N 148 LEU C O doub N N 149 LEU C OXT sing N N 150 LEU CB CG sing N N 151 LEU CB HB2 sing N N 152 LEU CB HB3 sing N N 153 LEU CG CD1 sing N N 154 LEU CG CD2 sing N N 155 LEU CG HG sing N N 156 LEU CD1 HD11 sing N N 157 LEU CD1 HD12 sing N N 158 LEU CD1 HD13 sing N N 159 LEU CD2 HD21 sing N N 160 LEU CD2 HD22 sing N N 161 LEU CD2 HD23 sing N N 162 LEU OXT HXT sing N N 163 LYS N CA sing N N 164 LYS N H sing N N 165 LYS N H2 sing N N 166 LYS CA C sing N N 167 LYS CA CB sing N N 168 LYS CA HA sing N N 169 LYS C O doub N N 170 LYS C OXT sing N N 171 LYS CB CG sing N N 172 LYS CB HB2 sing N N 173 LYS CB HB3 sing N N 174 LYS CG CD sing N N 175 LYS CG HG2 sing N N 176 LYS CG HG3 sing N N 177 LYS CD CE sing N N 178 LYS CD HD2 sing N N 179 LYS CD HD3 sing N N 180 LYS CE NZ sing N N 181 LYS CE HE2 sing N N 182 LYS CE HE3 sing N N 183 LYS NZ HZ1 sing N N 184 LYS NZ HZ2 sing N N 185 LYS NZ HZ3 sing N N 186 LYS OXT HXT sing N N 187 MET N CA sing N N 188 MET N H sing N N 189 MET N H2 sing N N 190 MET CA C sing N N 191 MET CA CB sing N N 192 MET CA HA sing N N 193 MET C O doub N N 194 MET C OXT sing N N 195 MET CB CG sing N N 196 MET CB HB2 sing N N 197 MET CB HB3 sing N N 198 MET CG SD sing N N 199 MET CG HG2 sing N N 200 MET CG HG3 sing N N 201 MET SD CE sing N N 202 MET CE HE1 sing N N 203 MET CE HE2 sing N N 204 MET CE HE3 sing N N 205 MET OXT HXT sing N N 206 PHE N CA sing N N 207 PHE N H sing N N 208 PHE N H2 sing N N 209 PHE CA C sing N N 210 PHE CA CB sing N N 211 PHE CA HA sing N N 212 PHE C O doub N N 213 PHE C OXT sing N N 214 PHE CB CG sing N N 215 PHE CB HB2 sing N N 216 PHE CB HB3 sing N N 217 PHE CG CD1 doub Y N 218 PHE CG CD2 sing Y N 219 PHE CD1 CE1 sing Y N 220 PHE CD1 HD1 sing N N 221 PHE CD2 CE2 doub Y N 222 PHE CD2 HD2 sing N N 223 PHE CE1 CZ doub Y N 224 PHE CE1 HE1 sing N N 225 PHE CE2 CZ sing Y N 226 PHE CE2 HE2 sing N N 227 PHE CZ HZ sing N N 228 PHE OXT HXT sing N N 229 SER N CA sing N N 230 SER N H sing N N 231 SER N H2 sing N N 232 SER CA C sing N N 233 SER CA CB sing N N 234 SER CA HA sing N N 235 SER C O doub N N 236 SER C OXT sing N N 237 SER CB OG sing N N 238 SER CB HB2 sing N N 239 SER CB HB3 sing N N 240 SER OG HG sing N N 241 SER OXT HXT sing N N 242 THR N CA sing N N 243 THR N H sing N N 244 THR N H2 sing N N 245 THR CA C sing N N 246 THR CA CB sing N N 247 THR CA HA sing N N 248 THR C O doub N N 249 THR C OXT sing N N 250 THR CB OG1 sing N N 251 THR CB CG2 sing N N 252 THR CB HB sing N N 253 THR OG1 HG1 sing N N 254 THR CG2 HG21 sing N N 255 THR CG2 HG22 sing N N 256 THR CG2 HG23 sing N N 257 THR OXT HXT sing N N 258 TYR N CA sing N N 259 TYR N H sing N N 260 TYR N H2 sing N N 261 TYR CA C sing N N 262 TYR CA CB sing N N 263 TYR CA HA sing N N 264 TYR C O doub N N 265 TYR C OXT sing N N 266 TYR CB CG sing N N 267 TYR CB HB2 sing N N 268 TYR CB HB3 sing N N 269 TYR CG CD1 doub Y N 270 TYR CG CD2 sing Y N 271 TYR CD1 CE1 sing Y N 272 TYR CD1 HD1 sing N N 273 TYR CD2 CE2 doub Y N 274 TYR CD2 HD2 sing N N 275 TYR CE1 CZ doub Y N 276 TYR CE1 HE1 sing N N 277 TYR CE2 CZ sing Y N 278 TYR CE2 HE2 sing N N 279 TYR CZ OH sing N N 280 TYR OH HH sing N N 281 TYR OXT HXT sing N N 282 VAL N CA sing N N 283 VAL N H sing N N 284 VAL N H2 sing N N 285 VAL CA C sing N N 286 VAL CA CB sing N N 287 VAL CA HA sing N N 288 VAL C O doub N N 289 VAL C OXT sing N N 290 VAL CB CG1 sing N N 291 VAL CB CG2 sing N N 292 VAL CB HB sing N N 293 VAL CG1 HG11 sing N N 294 VAL CG1 HG12 sing N N 295 VAL CG1 HG13 sing N N 296 VAL CG2 HG21 sing N N 297 VAL CG2 HG22 sing N N 298 VAL CG2 HG23 sing N N 299 VAL OXT HXT sing N N 300 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2JVD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_