data_2JXF # _entry.id 2JXF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JXF pdb_00002jxf 10.2210/pdb2jxf/pdb RCSB RCSB100411 ? ? BMRB 15559 ? ? WWPDB D_1000100411 ? ? # _pdbx_database_related.db_id 15559 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JXF _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-11-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Montserret, R.' 1 'Penin, F.' 2 # _citation.id primary _citation.title 'Identification of a Novel Determinant for Membrane Association in Hepatitis C Virus Nonstructural Protein 4B' _citation.journal_abbrev J.Virol. _citation.journal_volume 83 _citation.page_first 6257 _citation.page_last 6268 _citation.year 2009 _citation.journal_id_ASTM JOVIAM _citation.country US _citation.journal_id_ISSN 0022-538X _citation.journal_id_CSD 0825 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19357161 _citation.pdbx_database_id_DOI 10.1128/JVI.02663-08 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gouttenoire, J.' 1 ? primary 'Castet, V.' 2 ? primary 'Montserret, R.' 3 ? primary 'Arora, N.' 4 ? primary 'Raussens, V.' 5 ? primary 'Ruysschaert, J.-M.' 6 ? primary 'Diesis, E.' 7 ? primary 'Blum, H.E.' 8 ? primary 'Penin, F.' 9 ? primary 'Moradpour, D.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Genome polyprotein' _entity.formula_weight 3601.116 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Non-structural protein 4B, UNP residues 1751-1780' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NS4B(40-69)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code QTNWQKLEVFWAKHMWNFISGIQYLAGLST _entity_poly.pdbx_seq_one_letter_code_can QTNWQKLEVFWAKHMWNFISGIQYLAGLST _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 THR n 1 3 ASN n 1 4 TRP n 1 5 GLN n 1 6 LYS n 1 7 LEU n 1 8 GLU n 1 9 VAL n 1 10 PHE n 1 11 TRP n 1 12 ALA n 1 13 LYS n 1 14 HIS n 1 15 MET n 1 16 TRP n 1 17 ASN n 1 18 PHE n 1 19 ILE n 1 20 SER n 1 21 GLY n 1 22 ILE n 1 23 GLN n 1 24 TYR n 1 25 LEU n 1 26 ALA n 1 27 GLY n 1 28 LEU n 1 29 SER n 1 30 THR n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The peptide was synthesized by solid-phase synthesis; Free N and C termini' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POLG_HCVH _struct_ref.pdbx_db_accession P27958 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QTNWQKLEVFWAKHMWNFISGIQYLAGLST _struct_ref.pdbx_align_begin 1751 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JXF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P27958 _struct_ref_seq.db_align_beg 1751 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1780 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1mM NS4B(40-69); 50% v/v Trifluoro Ethanol D2OH; 50% v/v H2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '50% v/v Trifluoro Ethanol D2OH; 50% v/v H2O' # _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian UnityPlus' # _pdbx_nmr_refine.entry_id 2JXF _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JXF _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JXF _pdbx_nmr_representative.selection_criteria 'lowest rmsd deviation from the ensemble' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VNMR ? 1 Goddard 'chemical shift assignment' Sparky ? 2 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JXF _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JXF _struct.title 'The solution structure of HCV NS4B(40-69)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JXF _struct_keywords.pdbx_keywords 'VIRAL PROTEIN, MEMBRANE PROTEIN' _struct_keywords.text ;membrane associated segment, Acetylation, Apoptosis, ATP-binding, Capsid protein, Cytoplasm, Endoplasmic reticulum, Envelope protein, Fusion protein, Glycoprotein, Helicase, Host-virus interaction, Hydrolase, Interferon antiviral system evasion, Lipid droplet, Lipoprotein, Metal-binding, Mitochondrion, Multifunctional enzyme, Nucleotide-binding, Nucleotidyltransferase, Nucleus, Oncogene, Palmitate, Phosphoprotein, Protease, Ribonucleoprotein, RNA replication, RNA-binding, RNA-directed RNA polymerase, Secreted, Serine protease, SH3-binding, Thiol protease, Transcription, Transcription regulation, Transferase, Transmembrane, Ubl conjugation, Viral nucleoprotein, Virion, Zinc, VIRAL PROTEIN, MEMBRANE PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 28 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 2 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 28 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2JXF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 THR 30 30 30 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-11-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'NS4B(40-69)' 1 mM ? 1 'Trifluoro Ethanol D2OH' 50 % ? 1 H2O 50 % ? 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 2 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 7 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TRP _pdbx_validate_close_contact.auth_seq_id_2 11 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? -154.18 -119.59 2 2 THR A 2 ? ? -142.21 -105.05 3 2 LEU A 28 ? ? -101.57 51.34 4 3 THR A 2 ? ? -172.80 -131.67 5 3 LEU A 28 ? ? -169.67 63.48 6 4 THR A 2 ? ? -153.09 -52.09 7 4 ASN A 3 ? ? 84.55 -45.82 8 5 THR A 2 ? ? -124.61 -119.92 9 5 ASN A 3 ? ? 58.72 6.35 10 5 LEU A 28 ? ? -119.45 62.08 11 6 THR A 2 ? ? -92.17 -107.44 12 6 ASN A 3 ? ? 66.86 -4.68 13 7 THR A 2 ? ? 51.95 -109.49 14 7 ASN A 3 ? ? -156.37 -45.77 15 7 LEU A 28 ? ? -102.42 49.62 16 8 THR A 2 ? ? -139.79 -64.74 17 9 ALA A 26 ? ? -86.62 45.96 18 9 LEU A 28 ? ? 55.28 17.82 19 9 SER A 29 ? ? 173.74 152.20 20 10 THR A 2 ? ? 66.47 -63.17 21 10 ASN A 3 ? ? 81.73 -50.08 22 10 SER A 29 ? ? 58.47 -160.90 23 11 LEU A 25 ? ? -120.45 -51.06 24 11 SER A 29 ? ? -161.69 -60.45 25 12 THR A 2 ? ? -155.86 -119.78 26 12 SER A 29 ? ? 61.58 168.83 27 13 THR A 2 ? ? -158.89 -116.51 28 13 ALA A 26 ? ? -78.97 44.66 29 14 THR A 2 ? ? -144.18 -108.97 30 15 THR A 2 ? ? -109.26 -121.97 31 16 THR A 2 ? ? -143.62 -100.71 32 16 SER A 29 ? ? -80.59 -86.82 33 17 ASN A 3 ? ? 77.79 -52.62 34 17 SER A 29 ? ? 68.33 -64.29 35 18 THR A 2 ? ? -141.92 -117.74 36 18 LEU A 28 ? ? -103.95 48.95 37 19 SER A 29 ? ? 60.91 -160.76 38 20 LEU A 28 ? ? -101.71 49.55 39 21 LEU A 28 ? ? -116.54 59.32 40 22 THR A 2 ? ? -101.69 -89.57 41 22 LEU A 28 ? ? -98.53 45.54 42 23 THR A 2 ? ? 55.71 -98.85 43 23 SER A 29 ? ? 59.06 -165.15 44 24 THR A 2 ? ? -162.39 -119.82 45 25 ALA A 26 ? ? -82.59 42.37 46 26 THR A 2 ? ? -161.10 -115.47 47 26 GLN A 23 ? ? -92.71 44.98 48 26 TYR A 24 ? ? -153.19 -54.94 49 27 ALA A 26 ? ? -79.62 46.59 50 27 SER A 29 ? ? -90.33 -156.25 51 28 THR A 2 ? ? -165.23 -120.55 52 29 THR A 2 ? ? -144.21 -115.20 53 30 THR A 2 ? ? -164.90 -116.47 54 30 SER A 29 ? ? 62.85 -91.03 #