data_2KBQ # _entry.id 2KBQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KBQ pdb_00002kbq 10.2210/pdb2kbq/pdb RCSB RCSB100922 ? ? WWPDB D_1000100922 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2KBR 'harmonin N terminal domain in complex with a internal peptide of cadherin23' unspecified PDB 2KBS 'harmonin PDZ2 in complex with the carboxyl tail peptide of cadherin23' unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KBQ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-12-05 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, M.' 1 'Pan, L.' 2 'Yan, J.' 3 'Wu, L.' 4 # _citation.id primary _citation.title 'Assembling stable hair cell tip link complex via multidentate interactions between harmonin and cadherin 23' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 106 _citation.page_first 5575 _citation.page_last 5580 _citation.year 2009 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19297620 _citation.pdbx_database_id_DOI 10.1073/pnas.0901819106 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pan, L.' 1 ? primary 'Yan, J.' 2 ? primary 'Wu, L.' 3 ? primary 'Zhang, M.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Harmonin _entity.formula_weight 9567.099 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N terminal domain, residues 1-80' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Usher syndrome type-1C protein, Autoimmune enteropathy-related antigen AIE-75, Antigen NY-CO-38/NY-CO-37, PDZ-73 protein, Renal carcinoma antigen NY-REN-3 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPSRLPLFDAIRPLIPLKHQVEYDQLTPR _entity_poly.pdbx_seq_one_letter_code_can MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPSRLPLFDAIRPLIPLKHQVEYDQLTPR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ARG n 1 4 LYS n 1 5 VAL n 1 6 ALA n 1 7 ARG n 1 8 GLU n 1 9 PHE n 1 10 ARG n 1 11 HIS n 1 12 LYS n 1 13 VAL n 1 14 ASP n 1 15 PHE n 1 16 LEU n 1 17 ILE n 1 18 GLU n 1 19 ASN n 1 20 ASP n 1 21 ALA n 1 22 GLU n 1 23 LYS n 1 24 ASP n 1 25 TYR n 1 26 LEU n 1 27 TYR n 1 28 ASP n 1 29 VAL n 1 30 LEU n 1 31 ARG n 1 32 MET n 1 33 TYR n 1 34 HIS n 1 35 GLN n 1 36 THR n 1 37 MET n 1 38 ASP n 1 39 VAL n 1 40 ALA n 1 41 VAL n 1 42 LEU n 1 43 VAL n 1 44 GLY n 1 45 ASP n 1 46 LEU n 1 47 LYS n 1 48 LEU n 1 49 VAL n 1 50 ILE n 1 51 ASN n 1 52 GLU n 1 53 PRO n 1 54 SER n 1 55 ARG n 1 56 LEU n 1 57 PRO n 1 58 LEU n 1 59 PHE n 1 60 ASP n 1 61 ALA n 1 62 ILE n 1 63 ARG n 1 64 PRO n 1 65 LEU n 1 66 ILE n 1 67 PRO n 1 68 LEU n 1 69 LYS n 1 70 HIS n 1 71 GLN n 1 72 VAL n 1 73 GLU n 1 74 TYR n 1 75 ASP n 1 76 GLN n 1 77 LEU n 1 78 THR n 1 79 PRO n 1 80 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HARMONIN _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET32a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code USH1C_HUMAN _struct_ref.pdbx_db_accession Q9Y6N9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPSRLPLFDAIRPLIPLKHQVEYDQLTPR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KBQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y6N9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 80 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 80 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' 1 4 1 '3D 1H-13C NOESY' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '2D 1H-1H COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '100mM potassium phosphate-1, 1mM DTT-2, 1mM EDTA-3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KBQ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KBQ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 20 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KBQ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'data analysis' CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'chemical shift calculation' CNS ? 2 ? refinement CNS ? 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KBQ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KBQ _struct.title 'Solution structure of harmonin N terminal domain' _struct.pdbx_model_details 'lowest energy, model 20' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KBQ _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text ;PROTEIN, Alternative splicing, Coiled coil, Deafness, Hearing, Non-syndromic deafness, Polymorphism, Retinitis pigmentosa, Sensory transduction, Usher syndrome, Vision, STRUCTURAL PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 4 ? ILE A 17 ? LYS A 4 ILE A 17 1 ? 14 HELX_P HELX_P2 2 ASN A 19 ? MET A 37 ? ASN A 19 MET A 37 1 ? 19 HELX_P HELX_P3 3 ASP A 38 ? ASN A 51 ? ASP A 38 ASN A 51 1 ? 14 HELX_P HELX_P4 4 ARG A 55 ? PRO A 57 ? ARG A 55 PRO A 57 5 ? 3 HELX_P HELX_P5 5 LEU A 58 ? ILE A 66 ? LEU A 58 ILE A 66 1 ? 9 HELX_P HELX_P6 6 PRO A 67 ? THR A 78 ? PRO A 67 THR A 78 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KBQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ARG 80 80 80 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-03-31 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.concentration_range 'potassium phosphate-1' 100 mM ? 1 ? DTT-2 1 mM ? 1 ? EDTA-3 1 mM ? 1 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 4 ? ? 76.27 -58.15 2 1 ILE A 17 ? ? -71.72 -70.62 3 1 LEU A 68 ? ? -53.69 -74.71 4 1 PRO A 79 ? ? -74.84 -168.16 5 2 MET A 37 ? ? 62.71 67.94 6 2 LEU A 68 ? ? -50.80 -74.21 7 3 ILE A 17 ? ? -95.56 -80.90 8 3 ASP A 20 ? ? 74.13 -61.85 9 3 PRO A 67 ? ? -46.46 157.48 10 4 LYS A 4 ? ? -135.05 -47.92 11 4 ILE A 17 ? ? -88.19 -73.53 12 4 PRO A 67 ? ? -48.43 157.46 13 4 LEU A 68 ? ? -50.12 -72.25 14 4 PRO A 79 ? ? -65.14 89.99 15 5 ARG A 3 ? ? 60.09 174.04 16 5 LYS A 4 ? ? -132.15 -43.51 17 5 ILE A 17 ? ? -73.29 -70.43 18 5 PRO A 67 ? ? -47.28 156.10 19 6 ARG A 3 ? ? -98.12 37.84 20 6 ILE A 17 ? ? -103.10 -74.63 21 6 PRO A 67 ? ? -46.79 157.38 22 6 LEU A 68 ? ? -50.87 -70.66 23 7 LYS A 4 ? ? -134.33 -57.81 24 7 ILE A 50 ? ? -66.53 -87.77 25 7 PRO A 67 ? ? -49.48 157.57 26 7 LEU A 68 ? ? -50.23 -71.06 27 7 PRO A 79 ? ? -58.07 -161.50 28 8 ASP A 2 ? ? -98.00 35.18 29 8 ARG A 3 ? ? -177.08 84.08 30 8 LYS A 4 ? ? -121.39 -58.03 31 8 ILE A 50 ? ? -65.78 -85.22 32 9 ILE A 17 ? ? -96.61 -65.99 33 9 PRO A 53 ? ? -37.73 -29.70 34 10 ARG A 3 ? ? 60.05 170.57 35 10 LEU A 68 ? ? -50.30 -72.48 36 11 ARG A 3 ? ? -102.03 40.98 37 11 PRO A 67 ? ? -49.79 157.35 38 11 LEU A 68 ? ? -51.50 -73.76 39 12 ASP A 2 ? ? -98.66 31.81 40 12 ARG A 3 ? ? -152.87 76.65 41 12 MET A 37 ? ? 62.24 61.52 42 12 ILE A 50 ? ? -62.03 -86.13 43 12 PRO A 67 ? ? -49.59 157.49 44 12 LEU A 68 ? ? -50.37 -70.44 45 13 ASP A 2 ? ? -178.20 -64.10 46 13 LYS A 4 ? ? 75.29 -58.02 47 14 LYS A 4 ? ? -132.91 -49.28 48 14 LEU A 16 ? ? -84.47 -71.67 49 14 GLU A 18 ? ? 77.30 -4.22 50 14 PRO A 67 ? ? -48.59 157.75 51 15 LYS A 4 ? ? -136.52 -49.62 52 15 ILE A 17 ? ? -111.37 -81.98 53 15 ASP A 20 ? ? 74.31 -61.91 54 15 PRO A 67 ? ? -49.09 157.48 55 15 LEU A 68 ? ? -50.44 -72.88 56 16 LYS A 4 ? ? -129.27 -57.98 57 16 MET A 37 ? ? 65.94 60.70 58 16 ILE A 50 ? ? -68.05 -86.11 59 16 PRO A 67 ? ? -45.85 155.05 60 16 LEU A 68 ? ? -50.43 -74.53 61 17 ARG A 3 ? ? -167.56 -43.33 62 17 ILE A 17 ? ? -71.14 -70.47 63 17 LEU A 68 ? ? -50.09 -72.17 64 18 ASP A 2 ? ? -66.60 -177.86 65 18 LYS A 4 ? ? 73.84 -58.22 66 18 LEU A 16 ? ? -78.93 -73.95 67 18 ILE A 50 ? ? -62.92 -86.06 68 18 PRO A 67 ? ? -48.55 157.39 69 18 LEU A 68 ? ? -50.59 -77.22 70 18 PRO A 79 ? ? -71.28 -168.01 71 19 ARG A 3 ? ? -62.21 -76.53 72 19 LYS A 4 ? ? -153.39 -58.02 73 19 ILE A 17 ? ? -73.76 -70.69 74 19 ILE A 50 ? ? -68.35 -88.47 75 19 PRO A 67 ? ? -49.64 157.56 76 19 LEU A 68 ? ? -51.95 -74.13 77 19 PRO A 79 ? ? -69.11 -170.10 78 20 LYS A 4 ? ? -136.39 -47.95 79 20 ILE A 17 ? ? -89.99 -74.89 80 20 PRO A 79 ? ? -62.06 -166.77 #