data_2KCN # _entry.id 2KCN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KCN pdb_00002kcn 10.2210/pdb2kcn/pdb RCSB RCSB100954 ? ? BMRB 16087 ? 10.13018/BMR16087 WWPDB D_1000100954 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-07-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' Other 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 5 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KCN _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-12-23 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 16087 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Batta, G.' 1 'Barna, T.' 2 'Gaspari, Z.' 3 'Sandor, S.' 4 'Kover, K.E.' 5 'Binder, U.' 6 'Sarg, B.' 7 'Kaiserer, L.' 8 'Chhillar, A.K.' 9 'Eigentler, A.' 10 'Leiter, E.' 11 'Hegedus, N.' 12 'Pocsi, I.' 13 'Lindner, H.' 14 'Marx, F.' 15 # _citation.id primary _citation.title 'Functional aspects of the solution structure and dynamics of PAF--a highly-stable antifungal protein from Penicillium chrysogenum' _citation.journal_abbrev 'Febs J.' _citation.journal_volume 276 _citation.page_first 2875 _citation.page_last 2890 _citation.year 2009 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1742-464X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19459942 _citation.pdbx_database_id_DOI 10.1111/j.1742-4658.2009.07011.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Batta, G.' 1 ? primary 'Barna, T.' 2 ? primary 'Gaspari, Z.' 3 ? primary 'Sandor, S.' 4 ? primary 'Kover, K.E.' 5 ? primary 'Binder, U.' 6 ? primary 'Sarg, B.' 7 ? primary 'Kaiserer, L.' 8 ? primary 'Chhillar, A.K.' 9 ? primary 'Eigentler, A.' 10 ? primary 'Leiter, E.' 11 ? primary 'Hegedus, N.' 12 ? primary 'Pocsi, I.' 13 ? primary 'Lindner, H.' 14 ? primary 'Marx, F.' 15 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Antifungal protein' _entity.formula_weight 6263.099 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 38-92' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD _entity_poly.pdbx_seq_one_letter_code_can AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LYS n 1 3 TYR n 1 4 THR n 1 5 GLY n 1 6 LYS n 1 7 CYS n 1 8 THR n 1 9 LYS n 1 10 SER n 1 11 LYS n 1 12 ASN n 1 13 GLU n 1 14 CYS n 1 15 LYS n 1 16 TYR n 1 17 LYS n 1 18 ASN n 1 19 ASP n 1 20 ALA n 1 21 GLY n 1 22 LYS n 1 23 ASP n 1 24 THR n 1 25 PHE n 1 26 ILE n 1 27 LYS n 1 28 CYS n 1 29 PRO n 1 30 LYS n 1 31 PHE n 1 32 ASP n 1 33 ASN n 1 34 LYS n 1 35 LYS n 1 36 CYS n 1 37 THR n 1 38 LYS n 1 39 ASP n 1 40 ASN n 1 41 ASN n 1 42 LYS n 1 43 CYS n 1 44 THR n 1 45 VAL n 1 46 ASP n 1 47 THR n 1 48 TYR n 1 49 ASN n 1 50 ASN n 1 51 ALA n 1 52 VAL n 1 53 ASP n 1 54 CYS n 1 55 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Penicillium notatum' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene paf _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Penicillium chrysogenum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5076 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASP 55 55 55 ASP ASP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KCN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KCN _struct.title 'Solution structure of the antifungal protein PAF from Penicillium chrysogenum' _struct.pdbx_model_details 'closest to the average, model 4' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KCN _struct_keywords.pdbx_keywords 'ANTIFUNGAL PROTEIN' _struct_keywords.text 'antifungal protein PAF, ANTIFUNGAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q01701_PENCH _struct_ref.pdbx_db_accession Q01701 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD _struct_ref.pdbx_align_begin 38 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KCN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 55 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q01701 _struct_ref_seq.db_align_beg 38 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 55 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 2 ? GLY A 5 ? LYS A 2 GLY A 5 A 2 CYS A 43 ? ASP A 46 ? CYS A 43 ASP A 46 A 3 ALA A 51 ? CYS A 54 ? ALA A 51 CYS A 54 B 1 GLU A 13 ? ASN A 18 ? GLU A 13 ASN A 18 B 2 LYS A 22 ? LYS A 27 ? LYS A 22 LYS A 27 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 3 ? N TYR A 3 O VAL A 45 ? O VAL A 45 A 2 3 N THR A 44 ? N THR A 44 O ASP A 53 ? O ASP A 53 B 1 2 N CYS A 14 ? N CYS A 14 O ILE A 26 ? O ILE A 26 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 19 ? ? 72.12 -69.42 2 1 ALA A 20 ? ? -173.96 44.81 3 1 PRO A 29 ? ? -69.81 82.57 4 1 LYS A 34 ? ? -179.40 71.20 5 1 CYS A 36 ? ? 64.03 153.27 6 1 THR A 37 ? ? -154.76 39.12 7 1 LYS A 38 ? ? 178.33 130.74 8 1 ASN A 41 ? ? -61.20 -76.53 9 1 LYS A 42 ? ? -179.30 143.69 10 1 ASN A 49 ? ? -151.68 39.35 11 2 LYS A 15 ? ? -100.72 66.49 12 2 ASP A 19 ? ? 72.17 -69.32 13 2 ALA A 20 ? ? -170.21 52.10 14 2 ASP A 23 ? ? -51.97 108.59 15 2 PRO A 29 ? ? -69.78 86.24 16 2 ASP A 32 ? ? 63.51 86.10 17 2 ASN A 33 ? ? -177.00 -35.93 18 2 LYS A 34 ? ? -175.70 57.99 19 2 THR A 37 ? ? -148.87 39.84 20 2 ASN A 40 ? ? 61.77 75.01 21 2 ASN A 41 ? ? -84.42 -78.64 22 2 LYS A 42 ? ? -179.34 143.98 23 2 ASN A 49 ? ? -151.60 39.22 24 3 ASP A 19 ? ? 72.09 -69.43 25 3 ALA A 20 ? ? -175.28 42.35 26 3 PRO A 29 ? ? -69.71 80.43 27 3 ASN A 33 ? ? -179.85 -34.73 28 3 LYS A 34 ? ? -175.59 60.27 29 3 THR A 37 ? ? -154.11 39.76 30 3 LYS A 38 ? ? 179.64 155.03 31 3 ASN A 40 ? ? 61.89 74.34 32 3 ASN A 41 ? ? -84.49 -78.97 33 3 LYS A 42 ? ? -178.71 143.27 34 3 ASN A 49 ? ? -150.52 39.13 35 4 LYS A 11 ? ? -179.67 105.29 36 4 ASP A 19 ? ? 71.97 -69.52 37 4 ALA A 20 ? ? -177.12 39.92 38 4 ILE A 26 ? ? -173.91 122.46 39 4 PRO A 29 ? ? -69.77 78.92 40 4 ASN A 33 ? ? -178.43 -47.37 41 4 LYS A 34 ? ? -158.24 58.08 42 4 ASN A 41 ? ? -60.81 -167.23 43 4 CYS A 43 ? ? -116.93 -169.95 44 4 ASN A 49 ? ? -151.28 39.11 45 5 LYS A 11 ? ? -179.37 108.67 46 5 ASP A 19 ? ? 72.21 -69.44 47 5 ALA A 20 ? ? -173.85 40.88 48 5 PRO A 29 ? ? -69.78 76.68 49 5 LYS A 30 ? ? -151.11 46.53 50 5 ASN A 33 ? ? -179.38 -34.75 51 5 LYS A 34 ? ? -174.81 56.23 52 5 CYS A 36 ? ? 64.54 145.02 53 5 THR A 37 ? ? -154.83 37.62 54 5 LYS A 38 ? ? -177.96 131.75 55 5 ASN A 40 ? ? 62.38 75.66 56 5 ASN A 41 ? ? -79.06 -166.13 57 5 ASN A 49 ? ? -150.38 39.01 58 6 LYS A 15 ? ? -95.36 55.16 59 6 ASP A 19 ? ? 72.10 -69.49 60 6 ALA A 20 ? ? -178.36 40.02 61 6 ILE A 26 ? ? -168.97 37.82 62 6 LYS A 27 ? ? 55.08 178.18 63 6 PRO A 29 ? ? -69.75 71.43 64 6 ASP A 32 ? ? 51.52 85.55 65 6 ASN A 33 ? ? -179.88 -34.95 66 6 LYS A 34 ? ? -175.27 67.78 67 6 LYS A 38 ? ? -170.22 145.75 68 6 ASN A 41 ? ? -60.86 -168.38 69 6 THR A 44 ? ? -178.64 130.57 70 6 ASN A 49 ? ? -152.28 39.47 71 7 LYS A 15 ? ? -94.79 56.77 72 7 ASP A 19 ? ? 72.15 -69.50 73 7 ALA A 20 ? ? -175.75 39.99 74 7 PRO A 29 ? ? -69.73 86.63 75 7 ASP A 32 ? ? 63.48 87.27 76 7 ASN A 33 ? ? -178.36 -35.53 77 7 LYS A 34 ? ? -175.54 58.56 78 7 THR A 37 ? ? -158.47 38.94 79 7 LYS A 38 ? ? 179.50 126.42 80 7 ASN A 40 ? ? 59.58 70.88 81 7 ASN A 41 ? ? -92.40 -79.01 82 7 LYS A 42 ? ? 179.05 142.52 83 7 ASN A 49 ? ? -149.84 39.08 84 8 LYS A 9 ? ? 63.92 -82.69 85 8 ASP A 19 ? ? 71.41 -72.08 86 8 ALA A 20 ? ? 178.64 39.89 87 8 PRO A 29 ? ? -69.80 95.47 88 8 LYS A 30 ? ? -152.13 64.64 89 8 ASP A 32 ? ? 51.77 75.52 90 8 ASN A 33 ? ? -174.46 -36.58 91 8 LYS A 34 ? ? -176.27 64.86 92 8 THR A 37 ? ? -154.29 41.25 93 8 LYS A 38 ? ? 179.95 120.27 94 8 ASN A 40 ? ? 60.12 67.20 95 8 ASN A 41 ? ? -84.49 -78.45 96 8 LYS A 42 ? ? -179.44 138.49 97 8 ASN A 49 ? ? -150.12 39.12 98 9 LYS A 11 ? ? -160.53 117.54 99 9 TYR A 16 ? ? -121.79 -169.81 100 9 ASP A 19 ? ? 72.05 -69.66 101 9 ALA A 20 ? ? -176.36 49.26 102 9 PRO A 29 ? ? -69.80 66.87 103 9 ASN A 33 ? ? -135.58 -50.00 104 9 LYS A 34 ? ? -177.03 55.02 105 9 ASN A 40 ? ? 63.69 77.47 106 9 ASN A 41 ? ? -87.08 -79.64 107 9 LYS A 42 ? ? -179.12 142.83 108 9 ASN A 49 ? ? -151.55 39.30 109 9 ASN A 50 ? ? 50.70 72.50 110 10 LYS A 11 ? ? -174.09 127.95 111 10 ASP A 19 ? ? 71.99 -69.42 112 10 ALA A 20 ? ? -178.17 61.05 113 10 LYS A 30 ? ? -148.39 46.21 114 10 LYS A 34 ? ? 178.25 75.49 115 10 THR A 37 ? ? -154.31 39.01 116 10 LYS A 38 ? ? 178.08 127.42 117 10 ASN A 40 ? ? 59.61 72.06 118 10 ASN A 41 ? ? -89.70 -79.63 119 10 LYS A 42 ? ? 179.35 144.55 120 10 ASN A 49 ? ? -149.41 39.03 121 11 LYS A 11 ? ? -175.46 130.54 122 11 ASP A 19 ? ? 71.99 -69.56 123 11 ALA A 20 ? ? -171.48 41.51 124 11 ILE A 26 ? ? -169.84 39.67 125 11 LYS A 27 ? ? 56.56 172.45 126 11 PRO A 29 ? ? -69.66 84.64 127 11 LYS A 30 ? ? -153.31 60.96 128 11 ASP A 32 ? ? 51.26 82.05 129 11 ASN A 33 ? ? 179.82 -34.68 130 11 LYS A 34 ? ? -169.59 67.20 131 11 THR A 37 ? ? -154.30 40.34 132 11 LYS A 38 ? ? 179.02 120.90 133 11 ASN A 41 ? ? -83.88 -80.74 134 11 LYS A 42 ? ? -179.71 143.67 135 11 THR A 44 ? ? -178.38 145.88 136 11 ASN A 49 ? ? -151.40 39.23 137 12 ASP A 19 ? ? 64.15 -81.72 138 12 ALA A 20 ? ? -170.76 47.82 139 12 PRO A 29 ? ? -69.75 68.24 140 12 LYS A 30 ? ? -144.30 54.61 141 12 PHE A 31 ? ? -99.78 41.06 142 12 ASP A 32 ? ? 174.73 -25.89 143 12 LYS A 34 ? ? -179.58 72.71 144 12 CYS A 36 ? ? 62.12 159.25 145 12 THR A 37 ? ? -174.81 38.91 146 12 LYS A 38 ? ? 176.93 118.01 147 12 ASN A 40 ? ? 64.35 71.58 148 12 ASN A 41 ? ? -81.76 -79.48 149 12 LYS A 42 ? ? -179.43 143.60 150 12 ASN A 49 ? ? -151.48 39.25 151 13 ASP A 19 ? ? 71.50 -71.66 152 13 ALA A 20 ? ? 178.92 39.87 153 13 PRO A 29 ? ? -69.80 85.12 154 13 PHE A 31 ? ? -73.11 -164.57 155 13 ASP A 32 ? ? -49.11 90.85 156 13 ASN A 33 ? ? 177.65 -51.58 157 13 LYS A 34 ? ? -153.57 60.36 158 13 THR A 37 ? ? -151.27 47.08 159 13 LYS A 38 ? ? -175.83 146.66 160 13 ASN A 41 ? ? -61.13 -166.85 161 13 ASN A 49 ? ? -146.54 38.17 162 14 LYS A 9 ? ? -55.11 -74.68 163 14 LYS A 15 ? ? -104.07 59.79 164 14 ASP A 19 ? ? 71.71 -70.24 165 14 ALA A 20 ? ? -179.16 39.90 166 14 PRO A 29 ? ? -69.81 64.82 167 14 LYS A 30 ? ? -142.18 45.23 168 14 LYS A 34 ? ? -175.58 64.05 169 14 CYS A 36 ? ? 64.20 153.64 170 14 THR A 37 ? ? -148.76 39.02 171 14 LYS A 38 ? ? 177.98 130.20 172 14 ASN A 41 ? ? -60.23 -169.54 173 14 ASN A 49 ? ? -152.93 38.08 174 15 LYS A 11 ? ? -179.51 104.99 175 15 ASP A 19 ? ? 71.83 -69.69 176 15 ALA A 20 ? ? -178.22 40.14 177 15 PRO A 29 ? ? -69.76 64.84 178 15 LYS A 30 ? ? -144.39 53.01 179 15 PHE A 31 ? ? -98.98 39.70 180 15 ASP A 32 ? ? 174.89 -26.16 181 15 LYS A 34 ? ? -176.01 69.83 182 15 ASN A 41 ? ? -51.44 -77.39 183 15 LYS A 42 ? ? 179.78 148.71 184 15 ASN A 49 ? ? -151.27 38.80 185 16 LYS A 11 ? ? -179.95 113.30 186 16 ASP A 19 ? ? 72.12 -69.47 187 16 ALA A 20 ? ? -175.51 41.34 188 16 PRO A 29 ? ? -69.68 72.24 189 16 PHE A 31 ? ? -73.11 -164.12 190 16 ASP A 32 ? ? -47.05 91.25 191 16 ASN A 33 ? ? 175.87 -52.55 192 16 LYS A 34 ? ? -149.38 56.12 193 16 THR A 37 ? ? -146.42 39.92 194 16 LYS A 38 ? ? 179.26 122.97 195 16 ASN A 40 ? ? 62.59 75.37 196 16 ASN A 41 ? ? -88.31 -79.38 197 16 LYS A 42 ? ? -179.47 130.89 198 16 THR A 44 ? ? -172.43 149.05 199 16 ASN A 49 ? ? -151.47 39.22 200 17 LYS A 11 ? ? -179.54 96.44 201 17 ASP A 19 ? ? 72.02 -69.75 202 17 ALA A 20 ? ? -178.47 56.62 203 17 PRO A 29 ? ? -69.77 75.31 204 17 ASP A 32 ? ? 64.09 68.21 205 17 ASN A 33 ? ? -162.33 -49.72 206 17 LYS A 34 ? ? -176.88 55.47 207 17 ASN A 40 ? ? 54.08 70.66 208 17 ASN A 41 ? ? -79.89 -82.62 209 17 LYS A 42 ? ? 177.67 119.11 210 17 ASN A 49 ? ? -150.76 39.83 211 18 ASP A 19 ? ? 71.67 -70.92 212 18 ALA A 20 ? ? -179.41 40.99 213 18 ASP A 23 ? ? -59.90 96.96 214 18 LYS A 30 ? ? -163.61 49.91 215 18 ASP A 32 ? ? 66.37 64.77 216 18 ASN A 33 ? ? 179.88 -32.81 217 18 THR A 37 ? ? -154.79 41.22 218 18 LYS A 38 ? ? -179.82 125.50 219 18 ASN A 40 ? ? 61.15 62.19 220 18 ASN A 41 ? ? -70.48 -164.36 221 18 ASN A 49 ? ? -155.02 39.75 222 19 ASP A 19 ? ? 71.81 -70.13 223 19 ALA A 20 ? ? -178.92 63.62 224 19 PRO A 29 ? ? -69.73 79.19 225 19 ASP A 32 ? ? 56.82 73.68 226 19 ASN A 33 ? ? -178.45 -48.18 227 19 LYS A 34 ? ? -156.62 59.58 228 19 LYS A 38 ? ? -160.72 112.88 229 19 ASN A 41 ? ? -60.34 -169.80 230 19 ASN A 49 ? ? -155.50 39.58 231 19 ASN A 50 ? ? 60.28 69.65 232 20 LYS A 11 ? ? -174.72 108.88 233 20 ASP A 19 ? ? 71.98 -69.40 234 20 ALA A 20 ? ? -173.84 43.76 235 20 ILE A 26 ? ? -154.08 38.55 236 20 LYS A 27 ? ? 54.57 179.83 237 20 PRO A 29 ? ? -69.77 70.97 238 20 ASP A 32 ? ? 51.42 86.18 239 20 ASN A 33 ? ? -179.33 -40.25 240 20 LYS A 34 ? ? -174.97 66.48 241 20 THR A 37 ? ? -160.05 39.52 242 20 ASN A 41 ? ? -54.75 -75.60 243 20 LYS A 42 ? ? 178.09 146.95 244 20 ASN A 49 ? ? -146.78 37.39 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KCN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KCN _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '1.6mM [U-100% 15N] PAF-1, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample.component PAF-1 _pdbx_nmr_exptl_sample.concentration 1.6 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.04 _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 304 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '2D 1H-13C HSQC' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D 1H-15N TOCSY' # _pdbx_nmr_details.entry_id 2KCN _pdbx_nmr_details.text 'The structure was determined from the 2D NOESY (130ms mixing time) using ATNOS/CANDID/CYANA 2.0' # _pdbx_nmr_refine.entry_id 2KCN _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Herrmann, Guntert, Wuthrich' 'automated noe chemical shift assignment' CYANA 2.0 1 'Herrmann, Guntert, Wuthrich' 'nmr structure calculation' CYANA 2.0 2 'Herrmann, Guntert, Wuthrich' 'molecular dynamics calculation' CYANA 2.0 3 'Herrmann, Guntert, Wuthrich' 'protein structure data analysis' CYANA 2.0 4 'Herrmann, Guntert, Wuthrich' 'chemical shift assignment' CYANA 2.0 5 'Herrmann, Guntert, Wuthrich' collection CYANA 2.0 6 'Herrmann, Guntert, Wuthrich' refinement CYANA 2.0 7 'Guntert, Mumenthaler, Wuthrich' 'automated noe chemical shift assignment' CYANA 2.0 8 'Guntert, Mumenthaler, Wuthrich' 'nmr structure calculation' CYANA 2.0 9 'Guntert, Mumenthaler, Wuthrich' 'molecular dynamics calculation' CYANA 2.0 10 'Guntert, Mumenthaler, Wuthrich' 'protein structure data analysis' CYANA 2.0 11 'Guntert, Mumenthaler, Wuthrich' 'chemical shift assignment' CYANA 2.0 12 'Guntert, Mumenthaler, Wuthrich' collection CYANA 2.0 13 'GROMACS, Bekker, Berendse, Dijkstra' 'automated noe chemical shift assignment' CYANA 2.0 14 'GROMACS, Bekker, Berendse, Dijkstra' 'nmr structure calculation' CYANA 2.0 15 'GROMACS, Bekker, Berendse, Dijkstra' 'molecular dynamics calculation' CYANA 2.0 16 'GROMACS, Bekker, Berendse, Dijkstra' 'protein structure data analysis' CYANA 2.0 17 'GROMACS, Bekker, Berendse, Dijkstra' 'chemical shift assignment' CYANA 2.0 18 'GROMACS, Bekker, Berendse, Dijkstra' collection CYANA 2.0 19 'Laskowski, MacArthur' 'automated noe chemical shift assignment' CYANA 2.0 20 'Laskowski, MacArthur' 'nmr structure calculation' CYANA 2.0 21 'Laskowski, MacArthur' 'molecular dynamics calculation' CYANA 2.0 22 'Laskowski, MacArthur' 'protein structure data analysis' CYANA 2.0 23 'Laskowski, MacArthur' 'chemical shift assignment' CYANA 2.0 24 'Laskowski, MacArthur' collection CYANA 2.0 25 Goddard 'automated noe chemical shift assignment' CYANA 2.0 26 Goddard 'nmr structure calculation' CYANA 2.0 27 Goddard 'molecular dynamics calculation' CYANA 2.0 28 Goddard 'protein structure data analysis' CYANA 2.0 29 Goddard 'chemical shift assignment' CYANA 2.0 30 Goddard collection CYANA 2.0 31 'Bruker Biospin' 'automated noe chemical shift assignment' CYANA 2.0 32 'Bruker Biospin' 'nmr structure calculation' CYANA 2.0 33 'Bruker Biospin' 'molecular dynamics calculation' CYANA 2.0 34 'Bruker Biospin' 'protein structure data analysis' CYANA 2.0 35 'Bruker Biospin' 'chemical shift assignment' CYANA 2.0 36 'Bruker Biospin' collection CYANA 2.0 37 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLU N N N N 61 GLU CA C N S 62 GLU C C N N 63 GLU O O N N 64 GLU CB C N N 65 GLU CG C N N 66 GLU CD C N N 67 GLU OE1 O N N 68 GLU OE2 O N N 69 GLU OXT O N N 70 GLU H H N N 71 GLU H2 H N N 72 GLU HA H N N 73 GLU HB2 H N N 74 GLU HB3 H N N 75 GLU HG2 H N N 76 GLU HG3 H N N 77 GLU HE2 H N N 78 GLU HXT H N N 79 GLY N N N N 80 GLY CA C N N 81 GLY C C N N 82 GLY O O N N 83 GLY OXT O N N 84 GLY H H N N 85 GLY H2 H N N 86 GLY HA2 H N N 87 GLY HA3 H N N 88 GLY HXT H N N 89 ILE N N N N 90 ILE CA C N S 91 ILE C C N N 92 ILE O O N N 93 ILE CB C N S 94 ILE CG1 C N N 95 ILE CG2 C N N 96 ILE CD1 C N N 97 ILE OXT O N N 98 ILE H H N N 99 ILE H2 H N N 100 ILE HA H N N 101 ILE HB H N N 102 ILE HG12 H N N 103 ILE HG13 H N N 104 ILE HG21 H N N 105 ILE HG22 H N N 106 ILE HG23 H N N 107 ILE HD11 H N N 108 ILE HD12 H N N 109 ILE HD13 H N N 110 ILE HXT H N N 111 LYS N N N N 112 LYS CA C N S 113 LYS C C N N 114 LYS O O N N 115 LYS CB C N N 116 LYS CG C N N 117 LYS CD C N N 118 LYS CE C N N 119 LYS NZ N N N 120 LYS OXT O N N 121 LYS H H N N 122 LYS H2 H N N 123 LYS HA H N N 124 LYS HB2 H N N 125 LYS HB3 H N N 126 LYS HG2 H N N 127 LYS HG3 H N N 128 LYS HD2 H N N 129 LYS HD3 H N N 130 LYS HE2 H N N 131 LYS HE3 H N N 132 LYS HZ1 H N N 133 LYS HZ2 H N N 134 LYS HZ3 H N N 135 LYS HXT H N N 136 PHE N N N N 137 PHE CA C N S 138 PHE C C N N 139 PHE O O N N 140 PHE CB C N N 141 PHE CG C Y N 142 PHE CD1 C Y N 143 PHE CD2 C Y N 144 PHE CE1 C Y N 145 PHE CE2 C Y N 146 PHE CZ C Y N 147 PHE OXT O N N 148 PHE H H N N 149 PHE H2 H N N 150 PHE HA H N N 151 PHE HB2 H N N 152 PHE HB3 H N N 153 PHE HD1 H N N 154 PHE HD2 H N N 155 PHE HE1 H N N 156 PHE HE2 H N N 157 PHE HZ H N N 158 PHE HXT H N N 159 PRO N N N N 160 PRO CA C N S 161 PRO C C N N 162 PRO O O N N 163 PRO CB C N N 164 PRO CG C N N 165 PRO CD C N N 166 PRO OXT O N N 167 PRO H H N N 168 PRO HA H N N 169 PRO HB2 H N N 170 PRO HB3 H N N 171 PRO HG2 H N N 172 PRO HG3 H N N 173 PRO HD2 H N N 174 PRO HD3 H N N 175 PRO HXT H N N 176 SER N N N N 177 SER CA C N S 178 SER C C N N 179 SER O O N N 180 SER CB C N N 181 SER OG O N N 182 SER OXT O N N 183 SER H H N N 184 SER H2 H N N 185 SER HA H N N 186 SER HB2 H N N 187 SER HB3 H N N 188 SER HG H N N 189 SER HXT H N N 190 THR N N N N 191 THR CA C N S 192 THR C C N N 193 THR O O N N 194 THR CB C N R 195 THR OG1 O N N 196 THR CG2 C N N 197 THR OXT O N N 198 THR H H N N 199 THR H2 H N N 200 THR HA H N N 201 THR HB H N N 202 THR HG1 H N N 203 THR HG21 H N N 204 THR HG22 H N N 205 THR HG23 H N N 206 THR HXT H N N 207 TYR N N N N 208 TYR CA C N S 209 TYR C C N N 210 TYR O O N N 211 TYR CB C N N 212 TYR CG C Y N 213 TYR CD1 C Y N 214 TYR CD2 C Y N 215 TYR CE1 C Y N 216 TYR CE2 C Y N 217 TYR CZ C Y N 218 TYR OH O N N 219 TYR OXT O N N 220 TYR H H N N 221 TYR H2 H N N 222 TYR HA H N N 223 TYR HB2 H N N 224 TYR HB3 H N N 225 TYR HD1 H N N 226 TYR HD2 H N N 227 TYR HE1 H N N 228 TYR HE2 H N N 229 TYR HH H N N 230 TYR HXT H N N 231 VAL N N N N 232 VAL CA C N S 233 VAL C C N N 234 VAL O O N N 235 VAL CB C N N 236 VAL CG1 C N N 237 VAL CG2 C N N 238 VAL OXT O N N 239 VAL H H N N 240 VAL H2 H N N 241 VAL HA H N N 242 VAL HB H N N 243 VAL HG11 H N N 244 VAL HG12 H N N 245 VAL HG13 H N N 246 VAL HG21 H N N 247 VAL HG22 H N N 248 VAL HG23 H N N 249 VAL HXT H N N 250 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLU N CA sing N N 57 GLU N H sing N N 58 GLU N H2 sing N N 59 GLU CA C sing N N 60 GLU CA CB sing N N 61 GLU CA HA sing N N 62 GLU C O doub N N 63 GLU C OXT sing N N 64 GLU CB CG sing N N 65 GLU CB HB2 sing N N 66 GLU CB HB3 sing N N 67 GLU CG CD sing N N 68 GLU CG HG2 sing N N 69 GLU CG HG3 sing N N 70 GLU CD OE1 doub N N 71 GLU CD OE2 sing N N 72 GLU OE2 HE2 sing N N 73 GLU OXT HXT sing N N 74 GLY N CA sing N N 75 GLY N H sing N N 76 GLY N H2 sing N N 77 GLY CA C sing N N 78 GLY CA HA2 sing N N 79 GLY CA HA3 sing N N 80 GLY C O doub N N 81 GLY C OXT sing N N 82 GLY OXT HXT sing N N 83 ILE N CA sing N N 84 ILE N H sing N N 85 ILE N H2 sing N N 86 ILE CA C sing N N 87 ILE CA CB sing N N 88 ILE CA HA sing N N 89 ILE C O doub N N 90 ILE C OXT sing N N 91 ILE CB CG1 sing N N 92 ILE CB CG2 sing N N 93 ILE CB HB sing N N 94 ILE CG1 CD1 sing N N 95 ILE CG1 HG12 sing N N 96 ILE CG1 HG13 sing N N 97 ILE CG2 HG21 sing N N 98 ILE CG2 HG22 sing N N 99 ILE CG2 HG23 sing N N 100 ILE CD1 HD11 sing N N 101 ILE CD1 HD12 sing N N 102 ILE CD1 HD13 sing N N 103 ILE OXT HXT sing N N 104 LYS N CA sing N N 105 LYS N H sing N N 106 LYS N H2 sing N N 107 LYS CA C sing N N 108 LYS CA CB sing N N 109 LYS CA HA sing N N 110 LYS C O doub N N 111 LYS C OXT sing N N 112 LYS CB CG sing N N 113 LYS CB HB2 sing N N 114 LYS CB HB3 sing N N 115 LYS CG CD sing N N 116 LYS CG HG2 sing N N 117 LYS CG HG3 sing N N 118 LYS CD CE sing N N 119 LYS CD HD2 sing N N 120 LYS CD HD3 sing N N 121 LYS CE NZ sing N N 122 LYS CE HE2 sing N N 123 LYS CE HE3 sing N N 124 LYS NZ HZ1 sing N N 125 LYS NZ HZ2 sing N N 126 LYS NZ HZ3 sing N N 127 LYS OXT HXT sing N N 128 PHE N CA sing N N 129 PHE N H sing N N 130 PHE N H2 sing N N 131 PHE CA C sing N N 132 PHE CA CB sing N N 133 PHE CA HA sing N N 134 PHE C O doub N N 135 PHE C OXT sing N N 136 PHE CB CG sing N N 137 PHE CB HB2 sing N N 138 PHE CB HB3 sing N N 139 PHE CG CD1 doub Y N 140 PHE CG CD2 sing Y N 141 PHE CD1 CE1 sing Y N 142 PHE CD1 HD1 sing N N 143 PHE CD2 CE2 doub Y N 144 PHE CD2 HD2 sing N N 145 PHE CE1 CZ doub Y N 146 PHE CE1 HE1 sing N N 147 PHE CE2 CZ sing Y N 148 PHE CE2 HE2 sing N N 149 PHE CZ HZ sing N N 150 PHE OXT HXT sing N N 151 PRO N CA sing N N 152 PRO N CD sing N N 153 PRO N H sing N N 154 PRO CA C sing N N 155 PRO CA CB sing N N 156 PRO CA HA sing N N 157 PRO C O doub N N 158 PRO C OXT sing N N 159 PRO CB CG sing N N 160 PRO CB HB2 sing N N 161 PRO CB HB3 sing N N 162 PRO CG CD sing N N 163 PRO CG HG2 sing N N 164 PRO CG HG3 sing N N 165 PRO CD HD2 sing N N 166 PRO CD HD3 sing N N 167 PRO OXT HXT sing N N 168 SER N CA sing N N 169 SER N H sing N N 170 SER N H2 sing N N 171 SER CA C sing N N 172 SER CA CB sing N N 173 SER CA HA sing N N 174 SER C O doub N N 175 SER C OXT sing N N 176 SER CB OG sing N N 177 SER CB HB2 sing N N 178 SER CB HB3 sing N N 179 SER OG HG sing N N 180 SER OXT HXT sing N N 181 THR N CA sing N N 182 THR N H sing N N 183 THR N H2 sing N N 184 THR CA C sing N N 185 THR CA CB sing N N 186 THR CA HA sing N N 187 THR C O doub N N 188 THR C OXT sing N N 189 THR CB OG1 sing N N 190 THR CB CG2 sing N N 191 THR CB HB sing N N 192 THR OG1 HG1 sing N N 193 THR CG2 HG21 sing N N 194 THR CG2 HG22 sing N N 195 THR CG2 HG23 sing N N 196 THR OXT HXT sing N N 197 TYR N CA sing N N 198 TYR N H sing N N 199 TYR N H2 sing N N 200 TYR CA C sing N N 201 TYR CA CB sing N N 202 TYR CA HA sing N N 203 TYR C O doub N N 204 TYR C OXT sing N N 205 TYR CB CG sing N N 206 TYR CB HB2 sing N N 207 TYR CB HB3 sing N N 208 TYR CG CD1 doub Y N 209 TYR CG CD2 sing Y N 210 TYR CD1 CE1 sing Y N 211 TYR CD1 HD1 sing N N 212 TYR CD2 CE2 doub Y N 213 TYR CD2 HD2 sing N N 214 TYR CE1 CZ doub Y N 215 TYR CE1 HE1 sing N N 216 TYR CE2 CZ sing Y N 217 TYR CE2 HE2 sing N N 218 TYR CZ OH sing N N 219 TYR OH HH sing N N 220 TYR OXT HXT sing N N 221 VAL N CA sing N N 222 VAL N H sing N N 223 VAL N H2 sing N N 224 VAL CA C sing N N 225 VAL CA CB sing N N 226 VAL CA HA sing N N 227 VAL C O doub N N 228 VAL C OXT sing N N 229 VAL CB CG1 sing N N 230 VAL CB CG2 sing N N 231 VAL CB HB sing N N 232 VAL CG1 HG11 sing N N 233 VAL CG1 HG12 sing N N 234 VAL CG1 HG13 sing N N 235 VAL CG2 HG21 sing N N 236 VAL CG2 HG22 sing N N 237 VAL CG2 HG23 sing N N 238 VAL OXT HXT sing N N 239 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker DRX 1 'Bruker DRX' 700 Bruker DRX 2 'Bruker DRX' # _atom_sites.entry_id 2KCN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_