data_2KDN # _entry.id 2KDN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KDN pdb_00002kdn 10.2210/pdb2kdn/pdb RCSB RCSB100990 ? ? WWPDB D_1000100990 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-01-20 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2015-05-06 4 'Structure model' 1 3 2015-05-13 5 'Structure model' 1 4 2015-05-20 6 'Structure model' 1 5 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 6 'Structure model' 'Data collection' 6 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 6 'Structure model' chem_comp_atom 2 6 'Structure model' chem_comp_bond 3 6 'Structure model' database_2 4 6 'Structure model' pdbx_nmr_software 5 6 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 6 'Structure model' '_database_2.pdbx_DOI' 2 6 'Structure model' '_database_2.pdbx_database_accession' 3 6 'Structure model' '_pdbx_nmr_software.name' 4 6 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KDN _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-01-12 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id PlfaA.01650.a _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buchko, G.W.' 1 'Yee, A.' 2 'Semesi, A.' 3 'Hui, R.' 4 'Arrowsmith, C.H.' 5 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 6 # _citation.id primary _citation.title 'Solution-state NMR structure of the putative morphogene protein BolA (PFE0790c) from Plasmodium falciparum.' _citation.journal_abbrev 'Acta Crystallogr F Struct Biol Commun' _citation.journal_volume 71 _citation.page_first 514 _citation.page_last 521 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country DK _citation.journal_id_ISSN 1744-3091 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25945703 _citation.pdbx_database_id_DOI 10.1107/S2053230X1402799X # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 ? primary 'Yee, A.' 2 ? primary 'Semesi, A.' 3 ? primary 'Myler, P.J.' 4 ? primary 'Arrowsmith, C.H.' 5 ? primary 'Hui, R.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative uncharacterized protein PFE0790c' _entity.formula_weight 12328.100 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTIL KEELQNIHAFSMKCHTPLEYDKLKSKGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTIL KEELQNIHAFSMKCHTPLEYDKLKSKGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier PlfaA.01650.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 TYR n 1 19 PHE n 1 20 GLN n 1 21 GLY n 1 22 HIS n 1 23 MET n 1 24 CYS n 1 25 ILE n 1 26 GLN n 1 27 LYS n 1 28 VAL n 1 29 ILE n 1 30 GLU n 1 31 ASP n 1 32 LYS n 1 33 LEU n 1 34 SER n 1 35 SER n 1 36 ALA n 1 37 LEU n 1 38 LYS n 1 39 PRO n 1 40 THR n 1 41 PHE n 1 42 LEU n 1 43 GLU n 1 44 LEU n 1 45 VAL n 1 46 ASP n 1 47 LYS n 1 48 SER n 1 49 CYS n 1 50 GLY n 1 51 CYS n 1 52 GLY n 1 53 THR n 1 54 SER n 1 55 PHE n 1 56 ASP n 1 57 ALA n 1 58 VAL n 1 59 ILE n 1 60 VAL n 1 61 SER n 1 62 ASN n 1 63 ASN n 1 64 PHE n 1 65 GLU n 1 66 ASP n 1 67 LYS n 1 68 LYS n 1 69 LEU n 1 70 LEU n 1 71 ASP n 1 72 ARG n 1 73 HIS n 1 74 ARG n 1 75 LEU n 1 76 VAL n 1 77 ASN n 1 78 THR n 1 79 ILE n 1 80 LEU n 1 81 LYS n 1 82 GLU n 1 83 GLU n 1 84 LEU n 1 85 GLN n 1 86 ASN n 1 87 ILE n 1 88 HIS n 1 89 ALA n 1 90 PHE n 1 91 SER n 1 92 MET n 1 93 LYS n 1 94 CYS n 1 95 HIS n 1 96 THR n 1 97 PRO n 1 98 LEU n 1 99 GLU n 1 100 TYR n 1 101 ASP n 1 102 LYS n 1 103 LEU n 1 104 LYS n 1 105 SER n 1 106 LYS n 1 107 GLY n 1 108 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PFE0790c _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 3D7 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36329 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 SER 108 108 108 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KDN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KDN _struct.title 'Solution structure of PFE0790c, a putative bolA-like protein from the protozoan parasite Plasmodium falciparum.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KDN _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text ;NMR solution structure, SSGCID, Seattle Structural Genomics Center for Infectious Disease, structural genomics, malaria, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8I3V0_PLAF7 _struct_ref.pdbx_db_accession Q8I3V0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEYDK LKSK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KDN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8I3V0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KDN MET A 1 ? UNP Q8I3V0 ? ? 'expression tag' 1 1 1 2KDN GLY A 2 ? UNP Q8I3V0 ? ? 'expression tag' 2 2 1 2KDN SER A 3 ? UNP Q8I3V0 ? ? 'expression tag' 3 3 1 2KDN SER A 4 ? UNP Q8I3V0 ? ? 'expression tag' 4 4 1 2KDN HIS A 5 ? UNP Q8I3V0 ? ? 'expression tag' 5 5 1 2KDN HIS A 6 ? UNP Q8I3V0 ? ? 'expression tag' 6 6 1 2KDN HIS A 7 ? UNP Q8I3V0 ? ? 'expression tag' 7 7 1 2KDN HIS A 8 ? UNP Q8I3V0 ? ? 'expression tag' 8 8 1 2KDN HIS A 9 ? UNP Q8I3V0 ? ? 'expression tag' 9 9 1 2KDN HIS A 10 ? UNP Q8I3V0 ? ? 'expression tag' 10 10 1 2KDN SER A 11 ? UNP Q8I3V0 ? ? 'expression tag' 11 11 1 2KDN SER A 12 ? UNP Q8I3V0 ? ? 'expression tag' 12 12 1 2KDN GLY A 13 ? UNP Q8I3V0 ? ? 'expression tag' 13 13 1 2KDN ARG A 14 ? UNP Q8I3V0 ? ? 'expression tag' 14 14 1 2KDN GLU A 15 ? UNP Q8I3V0 ? ? 'expression tag' 15 15 1 2KDN ASN A 16 ? UNP Q8I3V0 ? ? 'expression tag' 16 16 1 2KDN LEU A 17 ? UNP Q8I3V0 ? ? 'expression tag' 17 17 1 2KDN TYR A 18 ? UNP Q8I3V0 ? ? 'expression tag' 18 18 1 2KDN PHE A 19 ? UNP Q8I3V0 ? ? 'expression tag' 19 19 1 2KDN GLN A 20 ? UNP Q8I3V0 ? ? 'expression tag' 20 20 1 2KDN GLY A 21 ? UNP Q8I3V0 ? ? 'expression tag' 21 21 1 2KDN HIS A 22 ? UNP Q8I3V0 ? ? 'expression tag' 22 22 1 2KDN GLY A 107 ? UNP Q8I3V0 ? ? 'expression tag' 107 23 1 2KDN SER A 108 ? UNP Q8I3V0 ? ? 'expression tag' 108 24 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 24 ? LYS A 38 ? CYS A 24 LYS A 38 1 ? 15 HELX_P HELX_P2 2 ASN A 62 ? GLU A 65 ? ASN A 62 GLU A 65 5 ? 4 HELX_P HELX_P3 3 LYS A 68 ? LEU A 84 ? LYS A 68 LEU A 84 1 ? 17 HELX_P HELX_P4 4 GLN A 85 ? ILE A 87 ? GLN A 85 ILE A 87 5 ? 3 HELX_P HELX_P5 5 THR A 96 ? LYS A 106 ? THR A 96 LYS A 106 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 41 ? ASP A 46 ? PHE A 41 ASP A 46 A 2 PHE A 55 ? VAL A 60 ? PHE A 55 VAL A 60 A 3 PHE A 90 ? HIS A 95 ? PHE A 90 HIS A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 45 ? N VAL A 45 O ASP A 56 ? O ASP A 56 A 2 3 N PHE A 55 ? N PHE A 55 O SER A 91 ? O SER A 91 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OD2 A ASP 66 ? ? HZ1 A LYS 68 ? ? 1.57 2 2 HG1 A THR 96 ? ? OE1 A GLU 99 ? ? 1.57 3 3 HZ2 A LYS 27 ? ? OE1 A GLU 30 ? ? 1.59 4 4 HZ3 A LYS 27 ? ? OE1 A GLU 30 ? ? 1.58 5 6 HD12 A ILE 59 ? ? HG A SER 61 ? ? 1.26 6 6 HE2 A HIS 6 ? ? OD1 A ASP 56 ? ? 1.58 7 7 HZ3 A LYS 27 ? ? OE1 A GLU 30 ? ? 1.53 8 8 HG1 A THR 96 ? ? OE1 A GLU 99 ? ? 1.57 9 9 HZ1 A LYS 27 ? ? OE1 A GLU 30 ? ? 1.58 10 10 OD2 A ASP 66 ? ? HZ1 A LYS 68 ? ? 1.55 11 10 HG1 A THR 96 ? ? OE1 A GLU 99 ? ? 1.58 12 10 HD1 A HIS 10 ? ? OD1 A ASP 31 ? ? 1.60 13 11 HZ2 A LYS 32 ? ? OE1 A GLU 83 ? ? 1.56 14 12 HZ3 A LYS 27 ? ? OE2 A GLU 30 ? ? 1.57 15 13 HG1 A THR 96 ? ? OE1 A GLU 99 ? ? 1.60 16 14 HE22 A GLN 26 ? ? HG A LEU 44 ? ? 1.34 17 14 HG1 A THR 96 ? ? OE1 A GLU 99 ? ? 1.56 18 15 HE2 A HIS 8 ? ? OE1 A GLU 30 ? ? 1.59 19 17 HZ3 A LYS 27 ? ? OD2 A ASP 31 ? ? 1.52 20 17 HZ1 A LYS 47 ? ? OD2 A ASP 56 ? ? 1.58 21 17 H1 A MET 1 ? ? OE2 A GLU 30 ? ? 1.60 22 18 HZ2 A LYS 32 ? ? OE1 A GLU 83 ? ? 1.57 23 19 HA A LEU 80 ? ? HB3 A GLU 83 ? ? 1.30 24 19 OD2 A ASP 66 ? ? HZ1 A LYS 68 ? ? 1.56 25 19 H2 A MET 1 ? ? O A SER 108 ? ? 1.57 26 20 HZ3 A LYS 27 ? ? OE2 A GLU 30 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 20 ? ? -82.98 31.31 2 1 LYS A 38 ? ? 49.55 76.39 3 1 LYS A 68 ? ? -69.50 89.79 4 2 HIS A 10 ? ? 63.56 72.74 5 2 GLU A 15 ? ? -88.98 36.24 6 2 MET A 23 ? ? 71.90 71.67 7 2 LYS A 38 ? ? 58.15 87.29 8 2 LYS A 106 ? ? -168.28 -41.97 9 3 SER A 11 ? ? -88.22 -146.53 10 3 LYS A 38 ? ? 65.16 74.77 11 3 SER A 105 ? ? -69.54 -71.30 12 4 GLU A 15 ? ? -119.48 61.55 13 4 LYS A 38 ? ? 56.92 83.94 14 4 SER A 105 ? ? -74.92 -75.47 15 5 ASN A 16 ? ? -68.72 2.21 16 5 LYS A 38 ? ? 60.99 78.78 17 5 CYS A 49 ? ? -105.41 -66.98 18 5 CYS A 51 ? ? 57.82 83.92 19 5 ASN A 63 ? ? -69.27 2.17 20 6 HIS A 7 ? ? 69.38 -52.79 21 6 HIS A 9 ? ? -84.54 -79.38 22 6 SER A 11 ? ? -105.05 -163.34 23 6 LYS A 38 ? ? 59.82 78.18 24 6 SER A 48 ? ? -172.68 98.91 25 6 ALA A 89 ? ? -162.32 102.00 26 7 GLU A 15 ? ? -145.65 36.63 27 7 HIS A 22 ? ? -102.32 -156.28 28 7 LYS A 38 ? ? 62.83 85.71 29 8 HIS A 9 ? ? -177.83 81.39 30 8 GLU A 15 ? ? -86.45 30.78 31 8 LYS A 38 ? ? 56.11 80.42 32 8 LYS A 106 ? ? -153.17 -44.38 33 9 HIS A 6 ? ? -81.58 30.68 34 9 HIS A 22 ? ? -159.06 64.37 35 9 LYS A 38 ? ? 55.57 88.46 36 9 THR A 53 ? ? 60.36 82.59 37 9 LYS A 106 ? ? -121.54 -56.54 38 10 HIS A 8 ? ? 69.43 -46.84 39 10 GLN A 20 ? ? -55.91 -78.37 40 10 LYS A 38 ? ? 61.12 68.07 41 10 SER A 48 ? ? -68.94 90.45 42 10 LYS A 67 ? ? 77.32 -13.82 43 10 LYS A 106 ? ? -132.92 -45.99 44 11 SER A 4 ? ? -177.84 111.92 45 11 ASN A 16 ? ? -59.32 -7.43 46 11 LYS A 38 ? ? 55.84 78.38 47 11 SER A 48 ? ? -67.01 83.88 48 11 ALA A 89 ? ? -162.15 105.94 49 11 LYS A 106 ? ? -153.13 -43.77 50 12 HIS A 8 ? ? -170.30 118.33 51 12 LYS A 38 ? ? 58.92 84.78 52 12 LYS A 47 ? ? -92.49 59.22 53 12 HIS A 88 ? ? -123.16 -73.85 54 12 ALA A 89 ? ? -104.91 57.72 55 13 HIS A 5 ? ? 31.94 45.98 56 13 HIS A 9 ? ? -176.16 118.82 57 13 SER A 12 ? ? 61.93 95.35 58 13 ASN A 16 ? ? -66.94 5.08 59 13 THR A 53 ? ? -64.33 98.02 60 13 LYS A 106 ? ? -134.38 -147.28 61 14 SER A 4 ? ? -81.83 37.63 62 14 HIS A 5 ? ? -57.53 107.55 63 14 SER A 11 ? ? 76.34 -50.11 64 14 GLN A 20 ? ? 73.47 -53.57 65 14 LYS A 38 ? ? 55.48 75.20 66 14 LYS A 47 ? ? -88.42 44.62 67 14 SER A 48 ? ? 65.56 75.69 68 14 THR A 53 ? ? -92.89 -87.65 69 15 SER A 3 ? ? -142.65 41.80 70 15 HIS A 5 ? ? -92.52 58.91 71 15 GLN A 20 ? ? -59.85 100.55 72 15 LYS A 38 ? ? 59.30 72.92 73 15 THR A 53 ? ? -119.59 52.87 74 15 ALA A 89 ? ? -161.08 108.41 75 16 HIS A 10 ? ? -170.48 133.42 76 16 SER A 11 ? ? -56.55 109.85 77 16 PHE A 19 ? ? -77.14 33.19 78 16 MET A 23 ? ? -58.02 100.52 79 16 LYS A 38 ? ? 58.01 81.22 80 16 LYS A 67 ? ? 78.61 -28.28 81 17 ARG A 14 ? ? -143.06 -34.35 82 17 LYS A 38 ? ? 51.01 75.30 83 17 CYS A 51 ? ? -78.46 38.85 84 18 GLU A 15 ? ? -91.15 30.20 85 18 GLN A 20 ? ? 72.65 -61.66 86 18 LYS A 38 ? ? 53.60 90.37 87 18 SER A 48 ? ? -79.92 27.93 88 18 LYS A 106 ? ? -144.74 -42.44 89 19 LYS A 38 ? ? 55.68 81.82 90 20 MET A 23 ? ? -66.95 96.31 91 20 LYS A 38 ? ? 56.67 75.12 92 20 LYS A 67 ? ? 53.60 13.85 # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KDN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KDN _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.5 mM [U-99% 13C; U-99% 15N] protein, 10 mM sodium phosphate, 200 mM sodium chloride, 10 mM DTT, 0.01 % sodium azide, 1 mM benzamidine, 93% H2O/7% D2O ; 1 '93% H2O/7% D2O' ;1.5 mM [U-7% 13C; U-99% 15N] protein, 10 mM sodium phosphate, 200 mM sodium chloride, 10 mM DTT, 0.01 % sodium azide, 1 mM benzamidine, 93% H2O/7% D2O ; 2 '93% H2O/7% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein 1.5 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate' 10 ? mM ? 1 'sodium chloride' 200 ? mM ? 1 DTT 10 ? mM ? 1 'sodium azide' 0.01 ? % ? 1 benzamidine 1 ? mM ? 1 protein 1.5 ? mM '[U-7% 13C; U-99% 15N]' 2 'sodium phosphate' 10 ? mM ? 2 'sodium chloride' 200 ? mM ? 2 DTT 10 ? mM ? 2 'sodium azide' 0.01 ? % ? 2 benzamidine 1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCA' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D 1H-13C NOESY' 1 8 1 '3D C(CO)NH' 1 9 1 '3D H(CCO)NH' 1 10 1 '2D 1H-15N HSQC' 1 11 2 '2D 1H-13C HSQC' 1 12 1 '3D HCCH-TOCSY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KDN _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 60 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1619 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 425 _pdbx_nmr_constraints.NOE_long_range_total_count 319 _pdbx_nmr_constraints.NOE_medium_range_total_count 399 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 476 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 63 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 63 # _pdbx_nmr_refine.entry_id 2KDN _pdbx_nmr_refine.method 'torsion angle dynamics, molecular dynamics' _pdbx_nmr_refine.details ;Structure determination was performed iteratively using CYANA (Automated NOESY Assignments). A total of 20 structures out of 100 with lowest target function from the final CYANA calculation were taken and refined by restrained molecular dynamics/energy minimization in explicit water (CNS) after adding 15% to the upper boundary limit. The final set of structures contained no dihedral violations greater than 1 degree and only 4 distance violations total that were greater than 0.05 Angstrom. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, P. et al.' 'structure solution' CYANA 3.0 1 'Goddard, T. et al.' 'data analysis' Sparky 3.110 2 'Goddard, T. et al.' 'peak picking' Sparky 3.110 3 'Accelrys Software Inc.' processing Felix 2007 4 'Brunger, A. et al.' refinement CNS 1.1 5 'Brunger, A. et al.' 'structure solution' CNS 1.1 6 'Bhattacharya, A. et al.' 'data analysis' PSVS 1.3 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' 800 Varian INOVA 3 'Varian INOVA' # _atom_sites.entry_id 2KDN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_