data_2KEO # _entry.id 2KEO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KEO pdb_00002keo 10.2210/pdb2keo/pdb RCSB RCSB101027 ? ? WWPDB D_1000101027 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-24 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-01-18 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KEO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-01-30 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id HT98A _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lemak, A.' 1 'Gutmanas, A.' 2 'Fares, C.' 3 'Quyang, H.' 4 'Li, Y.' 5 'Montelione, G.' 6 'Arrowsmith, C.' 7 'Dhe-Paganon, S.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution NMR Structure of human protein HS00059' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'A novel strategy for NMR resonance assignment and protein structure determination.' J.Biomol.Nmr 49 27 38 2011 JBNME9 NE 0925-2738 0800 ? 21161328 10.1007/s10858-010-9458-0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lemak, A.' 1 ? primary 'Gutmanas, A.' 2 ? primary 'Fares, C.' 3 ? primary 'Quyang, H.' 4 ? primary 'Li, Y.' 5 ? primary 'Montelione, G.' 6 ? primary 'Arrowsmith, C.' 7 ? primary 'Dhe-Paganon, S.' 8 ? 1 'Lemak, A.' 9 ? 1 'Gutmanas, A.' 10 ? 1 'Chitayat, S.' 11 ? 1 'Karra, M.' 12 ? 1 'Fares, C.' 13 ? 1 'Sunnerhagen, M.' 14 ? 1 'Arrowsmith, C.H.' 15 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Probable E3 ubiquitin-protein ligase HERC2' _entity.formula_weight 12650.789 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 6.3.2.- _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HECT domain and RCC1-like domain-containing protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGRENLYFQGNNEKVTLVRIADLENHNNDGGFWTVIDGKVYDIKDFQTQSLTENSILAQFAGEDPVVALEAA LQFEDTRESMHAFCVGQYLEPDQEGVTIPDLG ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGRENLYFQGNNEKVTLVRIADLENHNNDGGFWTVIDGKVYDIKDFQTQSLTENSILAQFAGEDPVVALEAA LQFEDTRESMHAFCVGQYLEPDQEGVTIPDLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HT98A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 ARG n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 GLY n 1 19 ASN n 1 20 ASN n 1 21 GLU n 1 22 LYS n 1 23 VAL n 1 24 THR n 1 25 LEU n 1 26 VAL n 1 27 ARG n 1 28 ILE n 1 29 ALA n 1 30 ASP n 1 31 LEU n 1 32 GLU n 1 33 ASN n 1 34 HIS n 1 35 ASN n 1 36 ASN n 1 37 ASP n 1 38 GLY n 1 39 GLY n 1 40 PHE n 1 41 TRP n 1 42 THR n 1 43 VAL n 1 44 ILE n 1 45 ASP n 1 46 GLY n 1 47 LYS n 1 48 VAL n 1 49 TYR n 1 50 ASP n 1 51 ILE n 1 52 LYS n 1 53 ASP n 1 54 PHE n 1 55 GLN n 1 56 THR n 1 57 GLN n 1 58 SER n 1 59 LEU n 1 60 THR n 1 61 GLU n 1 62 ASN n 1 63 SER n 1 64 ILE n 1 65 LEU n 1 66 ALA n 1 67 GLN n 1 68 PHE n 1 69 ALA n 1 70 GLY n 1 71 GLU n 1 72 ASP n 1 73 PRO n 1 74 VAL n 1 75 VAL n 1 76 ALA n 1 77 LEU n 1 78 GLU n 1 79 ALA n 1 80 ALA n 1 81 LEU n 1 82 GLN n 1 83 PHE n 1 84 GLU n 1 85 ASP n 1 86 THR n 1 87 ARG n 1 88 GLU n 1 89 SER n 1 90 MET n 1 91 HIS n 1 92 ALA n 1 93 PHE n 1 94 CYS n 1 95 VAL n 1 96 GLY n 1 97 GLN n 1 98 TYR n 1 99 LEU n 1 100 GLU n 1 101 PRO n 1 102 ASP n 1 103 GLN n 1 104 GLU n 1 105 GLY n 1 106 VAL n 1 107 THR n 1 108 ILE n 1 109 PRO n 1 110 ASP n 1 111 LEU n 1 112 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HERC2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector p15Tv-lic _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 HIS 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 GLY 10 10 ? ? ? A . n A 1 11 ARG 11 11 ? ? ? A . n A 1 12 GLU 12 12 ? ? ? A . n A 1 13 ASN 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 TYR 15 15 ? ? ? A . n A 1 16 PHE 16 16 ? ? ? A . n A 1 17 GLN 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 ASN 19 19 ? ? ? A . n A 1 20 ASN 20 20 ? ? ? A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLY 112 112 112 GLY GLY A . n # _cell.entry_id 2KEO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KEO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KEO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KEO _struct.title ;Solution NMR structure of human protein HS00059, cytochrome-b5-like domain of the HERC2 E3 ligase. Northeast structural genomics consortium (NESG) target ht98a ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KEO _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;protein of unknown function, HERC2 cytochrome domain, Ligase, Metal-binding, Phosphoprotein, Ubl conjugation pathway, WD repeat, Zinc-finger, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HERC2_HUMAN _struct_ref.pdbx_db_accession O95714 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVALEAALQFEDTRESMHAFCVGQY LEPDQEIVTIPDLG ; _struct_ref.pdbx_align_begin 1203 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KEO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 19 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O95714 _struct_ref_seq.db_align_beg 1203 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1296 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 19 _struct_ref_seq.pdbx_auth_seq_align_end 112 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KEO MET A 1 ? UNP O95714 ? ? 'expression tag' 1 1 1 2KEO HIS A 2 ? UNP O95714 ? ? 'expression tag' 2 2 1 2KEO HIS A 3 ? UNP O95714 ? ? 'expression tag' 3 3 1 2KEO HIS A 4 ? UNP O95714 ? ? 'expression tag' 4 4 1 2KEO HIS A 5 ? UNP O95714 ? ? 'expression tag' 5 5 1 2KEO HIS A 6 ? UNP O95714 ? ? 'expression tag' 6 6 1 2KEO HIS A 7 ? UNP O95714 ? ? 'expression tag' 7 7 1 2KEO SER A 8 ? UNP O95714 ? ? 'expression tag' 8 8 1 2KEO SER A 9 ? UNP O95714 ? ? 'expression tag' 9 9 1 2KEO GLY A 10 ? UNP O95714 ? ? 'expression tag' 10 10 1 2KEO ARG A 11 ? UNP O95714 ? ? 'expression tag' 11 11 1 2KEO GLU A 12 ? UNP O95714 ? ? 'expression tag' 12 12 1 2KEO ASN A 13 ? UNP O95714 ? ? 'expression tag' 13 13 1 2KEO LEU A 14 ? UNP O95714 ? ? 'expression tag' 14 14 1 2KEO TYR A 15 ? UNP O95714 ? ? 'expression tag' 15 15 1 2KEO PHE A 16 ? UNP O95714 ? ? 'expression tag' 16 16 1 2KEO GLN A 17 ? UNP O95714 ? ? 'expression tag' 17 17 1 2KEO GLY A 18 ? UNP O95714 ? ? 'expression tag' 18 18 1 2KEO LYS A 22 ? UNP O95714 GLU 1206 conflict 22 19 1 2KEO VAL A 26 ? UNP O95714 ILE 1210 conflict 26 20 1 2KEO ILE A 28 ? UNP O95714 LYS 1212 conflict 28 21 1 2KEO ASN A 36 ? UNP O95714 LYS 1220 conflict 36 22 1 2KEO GLU A 61 ? UNP O95714 GLY 1245 conflict 61 23 1 2KEO GLY A 105 ? UNP O95714 ILE 1289 conflict 105 24 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 27 ? GLY A 38 ? ARG A 27 GLY A 38 1 ? 12 HELX_P HELX_P2 2 ILE A 51 ? LEU A 59 ? ILE A 51 LEU A 59 1 ? 9 HELX_P HELX_P3 3 LEU A 65 ? ALA A 69 ? LEU A 65 ALA A 69 5 ? 5 HELX_P HELX_P4 4 ASP A 72 ? PHE A 83 ? ASP A 72 PHE A 83 1 ? 12 HELX_P HELX_P5 5 ASP A 85 ? GLU A 88 ? ASP A 85 GLU A 88 5 ? 4 HELX_P HELX_P6 6 SER A 89 ? PHE A 93 ? SER A 89 PHE A 93 1 ? 5 HELX_P HELX_P7 7 GLU A 100 ? GLY A 105 ? GLU A 100 GLY A 105 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 25 ? VAL A 26 ? LEU A 25 VAL A 26 A 2 CYS A 94 ? TYR A 98 ? CYS A 94 TYR A 98 A 3 LYS A 47 ? ASP A 50 ? LYS A 47 ASP A 50 A 4 TRP A 41 ? ILE A 44 ? TRP A 41 ILE A 44 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 26 ? N VAL A 26 O GLN A 97 ? O GLN A 97 A 2 3 O GLY A 96 ? O GLY A 96 N VAL A 48 ? N VAL A 48 A 3 4 O LYS A 47 ? O LYS A 47 N ILE A 44 ? N ILE A 44 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 62 ? ? 75.45 -3.56 2 2 LEU A 111 ? ? -176.76 -57.59 3 4 ASN A 62 ? ? -86.51 45.41 4 5 GLU A 104 ? ? -69.63 96.52 5 7 LEU A 111 ? ? -169.20 103.28 6 9 GLU A 61 ? ? -67.87 -73.56 7 10 LEU A 111 ? ? -162.50 -55.92 8 11 ALA A 69 ? ? -67.26 99.14 9 12 ASN A 62 ? ? -112.52 74.26 10 12 LEU A 111 ? ? -145.09 -71.17 11 13 ALA A 69 ? ? -67.65 94.39 12 13 LEU A 111 ? ? -159.46 -45.88 13 14 CYS A 94 ? ? -67.07 97.88 14 18 LYS A 22 ? ? -54.91 101.89 15 18 CYS A 94 ? ? -68.89 83.19 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KEO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KEO _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents ;0.5 mM [U-13C; U-15N] hs00059-1, 10 mM TRIS-2, 300 mM sodium chloride-3, 10 uM ZnSO4-4, 10 mM DTT-5, 0.01 % NaN3-6, 10 mM benzamidine-7, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id hs00059-1 0.5 ? mM '[U-13C; U-15N]' 1 TRIS-2 10 ? mM ? 1 'sodium chloride-3' 300 ? mM ? 1 ZnSO4-4 10 ? uM ? 1 DTT-5 10 ? mM ? 1 NaN3-6 0.01 ? % ? 1 benzamidine-7 10 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D 1H-13C_arom NOESY' # _pdbx_nmr_refine.entry_id 2KEO _pdbx_nmr_refine.method 'restrained molecular dynamics in water bath' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe . 1 Goddard 'peak picking' Sparky . 2 'Lemak, Steren, Llinas, Arrowsmith' 'chemical shift assignment' FMC . 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS . 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS . 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A HIS 2 ? A HIS 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A GLY 10 ? A GLY 10 11 1 Y 1 A ARG 11 ? A ARG 11 12 1 Y 1 A GLU 12 ? A GLU 12 13 1 Y 1 A ASN 13 ? A ASN 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A TYR 15 ? A TYR 15 16 1 Y 1 A PHE 16 ? A PHE 16 17 1 Y 1 A GLN 17 ? A GLN 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A ASN 19 ? A ASN 19 20 1 Y 1 A ASN 20 ? A ASN 20 21 2 Y 1 A MET 1 ? A MET 1 22 2 Y 1 A HIS 2 ? A HIS 2 23 2 Y 1 A HIS 3 ? A HIS 3 24 2 Y 1 A HIS 4 ? A HIS 4 25 2 Y 1 A HIS 5 ? A HIS 5 26 2 Y 1 A HIS 6 ? A HIS 6 27 2 Y 1 A HIS 7 ? A HIS 7 28 2 Y 1 A SER 8 ? A SER 8 29 2 Y 1 A SER 9 ? A SER 9 30 2 Y 1 A GLY 10 ? A GLY 10 31 2 Y 1 A ARG 11 ? A ARG 11 32 2 Y 1 A GLU 12 ? A GLU 12 33 2 Y 1 A ASN 13 ? A ASN 13 34 2 Y 1 A LEU 14 ? A LEU 14 35 2 Y 1 A TYR 15 ? A TYR 15 36 2 Y 1 A PHE 16 ? A PHE 16 37 2 Y 1 A GLN 17 ? A GLN 17 38 2 Y 1 A GLY 18 ? A GLY 18 39 2 Y 1 A ASN 19 ? A ASN 19 40 2 Y 1 A ASN 20 ? A ASN 20 41 3 Y 1 A MET 1 ? A MET 1 42 3 Y 1 A HIS 2 ? A HIS 2 43 3 Y 1 A HIS 3 ? A HIS 3 44 3 Y 1 A HIS 4 ? A HIS 4 45 3 Y 1 A HIS 5 ? A HIS 5 46 3 Y 1 A HIS 6 ? A HIS 6 47 3 Y 1 A HIS 7 ? A HIS 7 48 3 Y 1 A SER 8 ? A SER 8 49 3 Y 1 A SER 9 ? A SER 9 50 3 Y 1 A GLY 10 ? A GLY 10 51 3 Y 1 A ARG 11 ? A ARG 11 52 3 Y 1 A GLU 12 ? A GLU 12 53 3 Y 1 A ASN 13 ? A ASN 13 54 3 Y 1 A LEU 14 ? A LEU 14 55 3 Y 1 A TYR 15 ? A TYR 15 56 3 Y 1 A PHE 16 ? A PHE 16 57 3 Y 1 A GLN 17 ? A GLN 17 58 3 Y 1 A GLY 18 ? A GLY 18 59 3 Y 1 A ASN 19 ? A ASN 19 60 3 Y 1 A ASN 20 ? A ASN 20 61 4 Y 1 A MET 1 ? A MET 1 62 4 Y 1 A HIS 2 ? A HIS 2 63 4 Y 1 A HIS 3 ? A HIS 3 64 4 Y 1 A HIS 4 ? A HIS 4 65 4 Y 1 A HIS 5 ? A HIS 5 66 4 Y 1 A HIS 6 ? A HIS 6 67 4 Y 1 A HIS 7 ? A HIS 7 68 4 Y 1 A SER 8 ? A SER 8 69 4 Y 1 A SER 9 ? A SER 9 70 4 Y 1 A GLY 10 ? A GLY 10 71 4 Y 1 A ARG 11 ? A ARG 11 72 4 Y 1 A GLU 12 ? A GLU 12 73 4 Y 1 A ASN 13 ? A ASN 13 74 4 Y 1 A LEU 14 ? A LEU 14 75 4 Y 1 A TYR 15 ? A TYR 15 76 4 Y 1 A PHE 16 ? A PHE 16 77 4 Y 1 A GLN 17 ? A GLN 17 78 4 Y 1 A GLY 18 ? A GLY 18 79 4 Y 1 A ASN 19 ? A ASN 19 80 4 Y 1 A ASN 20 ? A ASN 20 81 5 Y 1 A MET 1 ? A MET 1 82 5 Y 1 A HIS 2 ? A HIS 2 83 5 Y 1 A HIS 3 ? A HIS 3 84 5 Y 1 A HIS 4 ? A HIS 4 85 5 Y 1 A HIS 5 ? A HIS 5 86 5 Y 1 A HIS 6 ? A HIS 6 87 5 Y 1 A HIS 7 ? A HIS 7 88 5 Y 1 A SER 8 ? A SER 8 89 5 Y 1 A SER 9 ? A SER 9 90 5 Y 1 A GLY 10 ? A GLY 10 91 5 Y 1 A ARG 11 ? A ARG 11 92 5 Y 1 A GLU 12 ? A GLU 12 93 5 Y 1 A ASN 13 ? A ASN 13 94 5 Y 1 A LEU 14 ? A LEU 14 95 5 Y 1 A TYR 15 ? A TYR 15 96 5 Y 1 A PHE 16 ? A PHE 16 97 5 Y 1 A GLN 17 ? A GLN 17 98 5 Y 1 A GLY 18 ? A GLY 18 99 5 Y 1 A ASN 19 ? A ASN 19 100 5 Y 1 A ASN 20 ? A ASN 20 101 6 Y 1 A MET 1 ? A MET 1 102 6 Y 1 A HIS 2 ? A HIS 2 103 6 Y 1 A HIS 3 ? A HIS 3 104 6 Y 1 A HIS 4 ? A HIS 4 105 6 Y 1 A HIS 5 ? A HIS 5 106 6 Y 1 A HIS 6 ? A HIS 6 107 6 Y 1 A HIS 7 ? A HIS 7 108 6 Y 1 A SER 8 ? A SER 8 109 6 Y 1 A SER 9 ? A SER 9 110 6 Y 1 A GLY 10 ? A GLY 10 111 6 Y 1 A ARG 11 ? A ARG 11 112 6 Y 1 A GLU 12 ? A GLU 12 113 6 Y 1 A ASN 13 ? A ASN 13 114 6 Y 1 A LEU 14 ? A LEU 14 115 6 Y 1 A TYR 15 ? A TYR 15 116 6 Y 1 A PHE 16 ? A PHE 16 117 6 Y 1 A GLN 17 ? A GLN 17 118 6 Y 1 A GLY 18 ? A GLY 18 119 6 Y 1 A ASN 19 ? A ASN 19 120 6 Y 1 A ASN 20 ? A ASN 20 121 7 Y 1 A MET 1 ? A MET 1 122 7 Y 1 A HIS 2 ? A HIS 2 123 7 Y 1 A HIS 3 ? A HIS 3 124 7 Y 1 A HIS 4 ? A HIS 4 125 7 Y 1 A HIS 5 ? A HIS 5 126 7 Y 1 A HIS 6 ? A HIS 6 127 7 Y 1 A HIS 7 ? A HIS 7 128 7 Y 1 A SER 8 ? A SER 8 129 7 Y 1 A SER 9 ? A SER 9 130 7 Y 1 A GLY 10 ? A GLY 10 131 7 Y 1 A ARG 11 ? A ARG 11 132 7 Y 1 A GLU 12 ? A GLU 12 133 7 Y 1 A ASN 13 ? A ASN 13 134 7 Y 1 A LEU 14 ? A LEU 14 135 7 Y 1 A TYR 15 ? A TYR 15 136 7 Y 1 A PHE 16 ? A PHE 16 137 7 Y 1 A GLN 17 ? A GLN 17 138 7 Y 1 A GLY 18 ? A GLY 18 139 7 Y 1 A ASN 19 ? A ASN 19 140 7 Y 1 A ASN 20 ? A ASN 20 141 8 Y 1 A MET 1 ? A MET 1 142 8 Y 1 A HIS 2 ? A HIS 2 143 8 Y 1 A HIS 3 ? A HIS 3 144 8 Y 1 A HIS 4 ? A HIS 4 145 8 Y 1 A HIS 5 ? A HIS 5 146 8 Y 1 A HIS 6 ? A HIS 6 147 8 Y 1 A HIS 7 ? A HIS 7 148 8 Y 1 A SER 8 ? A SER 8 149 8 Y 1 A SER 9 ? A SER 9 150 8 Y 1 A GLY 10 ? A GLY 10 151 8 Y 1 A ARG 11 ? A ARG 11 152 8 Y 1 A GLU 12 ? A GLU 12 153 8 Y 1 A ASN 13 ? A ASN 13 154 8 Y 1 A LEU 14 ? A LEU 14 155 8 Y 1 A TYR 15 ? A TYR 15 156 8 Y 1 A PHE 16 ? A PHE 16 157 8 Y 1 A GLN 17 ? A GLN 17 158 8 Y 1 A GLY 18 ? A GLY 18 159 8 Y 1 A ASN 19 ? A ASN 19 160 8 Y 1 A ASN 20 ? A ASN 20 161 9 Y 1 A MET 1 ? A MET 1 162 9 Y 1 A HIS 2 ? A HIS 2 163 9 Y 1 A HIS 3 ? A HIS 3 164 9 Y 1 A HIS 4 ? A HIS 4 165 9 Y 1 A HIS 5 ? A HIS 5 166 9 Y 1 A HIS 6 ? A HIS 6 167 9 Y 1 A HIS 7 ? A HIS 7 168 9 Y 1 A SER 8 ? A SER 8 169 9 Y 1 A SER 9 ? A SER 9 170 9 Y 1 A GLY 10 ? A GLY 10 171 9 Y 1 A ARG 11 ? A ARG 11 172 9 Y 1 A GLU 12 ? A GLU 12 173 9 Y 1 A ASN 13 ? A ASN 13 174 9 Y 1 A LEU 14 ? A LEU 14 175 9 Y 1 A TYR 15 ? A TYR 15 176 9 Y 1 A PHE 16 ? A PHE 16 177 9 Y 1 A GLN 17 ? A GLN 17 178 9 Y 1 A GLY 18 ? A GLY 18 179 9 Y 1 A ASN 19 ? A ASN 19 180 9 Y 1 A ASN 20 ? A ASN 20 181 10 Y 1 A MET 1 ? A MET 1 182 10 Y 1 A HIS 2 ? A HIS 2 183 10 Y 1 A HIS 3 ? A HIS 3 184 10 Y 1 A HIS 4 ? A HIS 4 185 10 Y 1 A HIS 5 ? A HIS 5 186 10 Y 1 A HIS 6 ? A HIS 6 187 10 Y 1 A HIS 7 ? A HIS 7 188 10 Y 1 A SER 8 ? A SER 8 189 10 Y 1 A SER 9 ? A SER 9 190 10 Y 1 A GLY 10 ? A GLY 10 191 10 Y 1 A ARG 11 ? A ARG 11 192 10 Y 1 A GLU 12 ? A GLU 12 193 10 Y 1 A ASN 13 ? A ASN 13 194 10 Y 1 A LEU 14 ? A LEU 14 195 10 Y 1 A TYR 15 ? A TYR 15 196 10 Y 1 A PHE 16 ? A PHE 16 197 10 Y 1 A GLN 17 ? A GLN 17 198 10 Y 1 A GLY 18 ? A GLY 18 199 10 Y 1 A ASN 19 ? A ASN 19 200 10 Y 1 A ASN 20 ? A ASN 20 201 11 Y 1 A MET 1 ? A MET 1 202 11 Y 1 A HIS 2 ? A HIS 2 203 11 Y 1 A HIS 3 ? A HIS 3 204 11 Y 1 A HIS 4 ? A HIS 4 205 11 Y 1 A HIS 5 ? A HIS 5 206 11 Y 1 A HIS 6 ? A HIS 6 207 11 Y 1 A HIS 7 ? A HIS 7 208 11 Y 1 A SER 8 ? A SER 8 209 11 Y 1 A SER 9 ? A SER 9 210 11 Y 1 A GLY 10 ? A GLY 10 211 11 Y 1 A ARG 11 ? A ARG 11 212 11 Y 1 A GLU 12 ? A GLU 12 213 11 Y 1 A ASN 13 ? A ASN 13 214 11 Y 1 A LEU 14 ? A LEU 14 215 11 Y 1 A TYR 15 ? A TYR 15 216 11 Y 1 A PHE 16 ? A PHE 16 217 11 Y 1 A GLN 17 ? A GLN 17 218 11 Y 1 A GLY 18 ? A GLY 18 219 11 Y 1 A ASN 19 ? A ASN 19 220 11 Y 1 A ASN 20 ? A ASN 20 221 12 Y 1 A MET 1 ? A MET 1 222 12 Y 1 A HIS 2 ? A HIS 2 223 12 Y 1 A HIS 3 ? A HIS 3 224 12 Y 1 A HIS 4 ? A HIS 4 225 12 Y 1 A HIS 5 ? A HIS 5 226 12 Y 1 A HIS 6 ? A HIS 6 227 12 Y 1 A HIS 7 ? A HIS 7 228 12 Y 1 A SER 8 ? A SER 8 229 12 Y 1 A SER 9 ? A SER 9 230 12 Y 1 A GLY 10 ? A GLY 10 231 12 Y 1 A ARG 11 ? A ARG 11 232 12 Y 1 A GLU 12 ? A GLU 12 233 12 Y 1 A ASN 13 ? A ASN 13 234 12 Y 1 A LEU 14 ? A LEU 14 235 12 Y 1 A TYR 15 ? A TYR 15 236 12 Y 1 A PHE 16 ? A PHE 16 237 12 Y 1 A GLN 17 ? A GLN 17 238 12 Y 1 A GLY 18 ? A GLY 18 239 12 Y 1 A ASN 19 ? A ASN 19 240 12 Y 1 A ASN 20 ? A ASN 20 241 13 Y 1 A MET 1 ? A MET 1 242 13 Y 1 A HIS 2 ? A HIS 2 243 13 Y 1 A HIS 3 ? A HIS 3 244 13 Y 1 A HIS 4 ? A HIS 4 245 13 Y 1 A HIS 5 ? A HIS 5 246 13 Y 1 A HIS 6 ? A HIS 6 247 13 Y 1 A HIS 7 ? A HIS 7 248 13 Y 1 A SER 8 ? A SER 8 249 13 Y 1 A SER 9 ? A SER 9 250 13 Y 1 A GLY 10 ? A GLY 10 251 13 Y 1 A ARG 11 ? A ARG 11 252 13 Y 1 A GLU 12 ? A GLU 12 253 13 Y 1 A ASN 13 ? A ASN 13 254 13 Y 1 A LEU 14 ? A LEU 14 255 13 Y 1 A TYR 15 ? A TYR 15 256 13 Y 1 A PHE 16 ? A PHE 16 257 13 Y 1 A GLN 17 ? A GLN 17 258 13 Y 1 A GLY 18 ? A GLY 18 259 13 Y 1 A ASN 19 ? A ASN 19 260 13 Y 1 A ASN 20 ? A ASN 20 261 14 Y 1 A MET 1 ? A MET 1 262 14 Y 1 A HIS 2 ? A HIS 2 263 14 Y 1 A HIS 3 ? A HIS 3 264 14 Y 1 A HIS 4 ? A HIS 4 265 14 Y 1 A HIS 5 ? A HIS 5 266 14 Y 1 A HIS 6 ? A HIS 6 267 14 Y 1 A HIS 7 ? A HIS 7 268 14 Y 1 A SER 8 ? A SER 8 269 14 Y 1 A SER 9 ? A SER 9 270 14 Y 1 A GLY 10 ? A GLY 10 271 14 Y 1 A ARG 11 ? A ARG 11 272 14 Y 1 A GLU 12 ? A GLU 12 273 14 Y 1 A ASN 13 ? A ASN 13 274 14 Y 1 A LEU 14 ? A LEU 14 275 14 Y 1 A TYR 15 ? A TYR 15 276 14 Y 1 A PHE 16 ? A PHE 16 277 14 Y 1 A GLN 17 ? A GLN 17 278 14 Y 1 A GLY 18 ? A GLY 18 279 14 Y 1 A ASN 19 ? A ASN 19 280 14 Y 1 A ASN 20 ? A ASN 20 281 15 Y 1 A MET 1 ? A MET 1 282 15 Y 1 A HIS 2 ? A HIS 2 283 15 Y 1 A HIS 3 ? A HIS 3 284 15 Y 1 A HIS 4 ? A HIS 4 285 15 Y 1 A HIS 5 ? A HIS 5 286 15 Y 1 A HIS 6 ? A HIS 6 287 15 Y 1 A HIS 7 ? A HIS 7 288 15 Y 1 A SER 8 ? A SER 8 289 15 Y 1 A SER 9 ? A SER 9 290 15 Y 1 A GLY 10 ? A GLY 10 291 15 Y 1 A ARG 11 ? A ARG 11 292 15 Y 1 A GLU 12 ? A GLU 12 293 15 Y 1 A ASN 13 ? A ASN 13 294 15 Y 1 A LEU 14 ? A LEU 14 295 15 Y 1 A TYR 15 ? A TYR 15 296 15 Y 1 A PHE 16 ? A PHE 16 297 15 Y 1 A GLN 17 ? A GLN 17 298 15 Y 1 A GLY 18 ? A GLY 18 299 15 Y 1 A ASN 19 ? A ASN 19 300 15 Y 1 A ASN 20 ? A ASN 20 301 16 Y 1 A MET 1 ? A MET 1 302 16 Y 1 A HIS 2 ? A HIS 2 303 16 Y 1 A HIS 3 ? A HIS 3 304 16 Y 1 A HIS 4 ? A HIS 4 305 16 Y 1 A HIS 5 ? A HIS 5 306 16 Y 1 A HIS 6 ? A HIS 6 307 16 Y 1 A HIS 7 ? A HIS 7 308 16 Y 1 A SER 8 ? A SER 8 309 16 Y 1 A SER 9 ? A SER 9 310 16 Y 1 A GLY 10 ? A GLY 10 311 16 Y 1 A ARG 11 ? A ARG 11 312 16 Y 1 A GLU 12 ? A GLU 12 313 16 Y 1 A ASN 13 ? A ASN 13 314 16 Y 1 A LEU 14 ? A LEU 14 315 16 Y 1 A TYR 15 ? A TYR 15 316 16 Y 1 A PHE 16 ? A PHE 16 317 16 Y 1 A GLN 17 ? A GLN 17 318 16 Y 1 A GLY 18 ? A GLY 18 319 16 Y 1 A ASN 19 ? A ASN 19 320 16 Y 1 A ASN 20 ? A ASN 20 321 17 Y 1 A MET 1 ? A MET 1 322 17 Y 1 A HIS 2 ? A HIS 2 323 17 Y 1 A HIS 3 ? A HIS 3 324 17 Y 1 A HIS 4 ? A HIS 4 325 17 Y 1 A HIS 5 ? A HIS 5 326 17 Y 1 A HIS 6 ? A HIS 6 327 17 Y 1 A HIS 7 ? A HIS 7 328 17 Y 1 A SER 8 ? A SER 8 329 17 Y 1 A SER 9 ? A SER 9 330 17 Y 1 A GLY 10 ? A GLY 10 331 17 Y 1 A ARG 11 ? A ARG 11 332 17 Y 1 A GLU 12 ? A GLU 12 333 17 Y 1 A ASN 13 ? A ASN 13 334 17 Y 1 A LEU 14 ? A LEU 14 335 17 Y 1 A TYR 15 ? A TYR 15 336 17 Y 1 A PHE 16 ? A PHE 16 337 17 Y 1 A GLN 17 ? A GLN 17 338 17 Y 1 A GLY 18 ? A GLY 18 339 17 Y 1 A ASN 19 ? A ASN 19 340 17 Y 1 A ASN 20 ? A ASN 20 341 18 Y 1 A MET 1 ? A MET 1 342 18 Y 1 A HIS 2 ? A HIS 2 343 18 Y 1 A HIS 3 ? A HIS 3 344 18 Y 1 A HIS 4 ? A HIS 4 345 18 Y 1 A HIS 5 ? A HIS 5 346 18 Y 1 A HIS 6 ? A HIS 6 347 18 Y 1 A HIS 7 ? A HIS 7 348 18 Y 1 A SER 8 ? A SER 8 349 18 Y 1 A SER 9 ? A SER 9 350 18 Y 1 A GLY 10 ? A GLY 10 351 18 Y 1 A ARG 11 ? A ARG 11 352 18 Y 1 A GLU 12 ? A GLU 12 353 18 Y 1 A ASN 13 ? A ASN 13 354 18 Y 1 A LEU 14 ? A LEU 14 355 18 Y 1 A TYR 15 ? A TYR 15 356 18 Y 1 A PHE 16 ? A PHE 16 357 18 Y 1 A GLN 17 ? A GLN 17 358 18 Y 1 A GLY 18 ? A GLY 18 359 18 Y 1 A ASN 19 ? A ASN 19 360 18 Y 1 A ASN 20 ? A ASN 20 361 19 Y 1 A MET 1 ? A MET 1 362 19 Y 1 A HIS 2 ? A HIS 2 363 19 Y 1 A HIS 3 ? A HIS 3 364 19 Y 1 A HIS 4 ? A HIS 4 365 19 Y 1 A HIS 5 ? A HIS 5 366 19 Y 1 A HIS 6 ? A HIS 6 367 19 Y 1 A HIS 7 ? A HIS 7 368 19 Y 1 A SER 8 ? A SER 8 369 19 Y 1 A SER 9 ? A SER 9 370 19 Y 1 A GLY 10 ? A GLY 10 371 19 Y 1 A ARG 11 ? A ARG 11 372 19 Y 1 A GLU 12 ? A GLU 12 373 19 Y 1 A ASN 13 ? A ASN 13 374 19 Y 1 A LEU 14 ? A LEU 14 375 19 Y 1 A TYR 15 ? A TYR 15 376 19 Y 1 A PHE 16 ? A PHE 16 377 19 Y 1 A GLN 17 ? A GLN 17 378 19 Y 1 A GLY 18 ? A GLY 18 379 19 Y 1 A ASN 19 ? A ASN 19 380 19 Y 1 A ASN 20 ? A ASN 20 381 20 Y 1 A MET 1 ? A MET 1 382 20 Y 1 A HIS 2 ? A HIS 2 383 20 Y 1 A HIS 3 ? A HIS 3 384 20 Y 1 A HIS 4 ? A HIS 4 385 20 Y 1 A HIS 5 ? A HIS 5 386 20 Y 1 A HIS 6 ? A HIS 6 387 20 Y 1 A HIS 7 ? A HIS 7 388 20 Y 1 A SER 8 ? A SER 8 389 20 Y 1 A SER 9 ? A SER 9 390 20 Y 1 A GLY 10 ? A GLY 10 391 20 Y 1 A ARG 11 ? A ARG 11 392 20 Y 1 A GLU 12 ? A GLU 12 393 20 Y 1 A ASN 13 ? A ASN 13 394 20 Y 1 A LEU 14 ? A LEU 14 395 20 Y 1 A TYR 15 ? A TYR 15 396 20 Y 1 A PHE 16 ? A PHE 16 397 20 Y 1 A GLN 17 ? A GLN 17 398 20 Y 1 A GLY 18 ? A GLY 18 399 20 Y 1 A ASN 19 ? A ASN 19 400 20 Y 1 A ASN 20 ? A ASN 20 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2KEO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_