data_2KTV # _entry.id 2KTV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KTV pdb_00002ktv 10.2210/pdb2ktv/pdb RCSB RCSB101566 ? ? WWPDB D_1000101566 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-08-18 4 'Structure model' 1 3 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Experimental preparation' 5 3 'Structure model' 'Structure summary' 6 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_exptl 3 3 'Structure model' pdbx_nmr_exptl_sample 4 3 'Structure model' pdbx_nmr_representative 5 3 'Structure model' pdbx_nmr_sample_details 6 3 'Structure model' pdbx_nmr_software 7 3 'Structure model' pdbx_nmr_spectrometer 8 3 'Structure model' struct 9 3 'Structure model' struct_ref_seq_dif 10 4 'Structure model' chem_comp_atom 11 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_exptl_sample.component' 4 3 'Structure model' '_pdbx_nmr_exptl_sample.isotopic_labeling' 5 3 'Structure model' '_pdbx_nmr_representative.selection_criteria' 6 3 'Structure model' '_pdbx_nmr_software.authors' 7 3 'Structure model' '_pdbx_nmr_software.classification' 8 3 'Structure model' '_pdbx_nmr_software.name' 9 3 'Structure model' '_struct.pdbx_model_details' 10 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KTV _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-02-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 15366 BMRB 'Human eRF1 C domain' unspecified 6763 BMRB 'Human eRF1 middle domain' unspecified 2HST PDB 'Human eRF1 middle domain' unspecified 6116 BMRB 'Human eRF1 N-domain' unspecified 1DT9 PDB 'The crystal structure of human eukaryotic release factor eRF1' unspecified 2KTU PDB 'Human eRF1 C domain' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mantsyzov, A.B.' 1 'Polshakov, V.I.' 2 'Birdsall, B.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR solution structure and function of the C-terminal domain of eukaryotic class 1 polypeptide chain release factor.' 'Febs J.' 277 2611 2627 2010 ? UK 1742-464X ? ? 20553496 10.1111/j.1742-464X.2010.07672.x 1 'NMR assignments of the C-terminal domain of human polypeptide release factor eRF1.' 'Biomol.Nmr Assign.' 1 183 185 2007 ? NE 1874-2718 ? ? 19636860 10.1007/s12104-007-9050-z # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mantsyzov, A.B.' 1 ? primary 'Ivanova, E.V.' 2 ? primary 'Birdsall, B.' 3 ? primary 'Alkalaeva, E.Z.' 4 ? primary 'Kryuchkova, P.N.' 5 ? primary 'Kelly, G.' 6 ? primary 'Frolova, L.Y.' 7 ? primary 'Polshakov, V.I.' 8 ? 1 'Mantsyzov, A.B.' 9 ? 1 'Ivanova, E.V.' 10 ? 1 'Birdsall, B.' 11 ? 1 'Kolosov, P.M.' 12 ? 1 'Kisselev, L.L.' 13 ? 1 'Polshakov, V.I.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Eukaryotic peptide chain release factor subunit 1' _entity.formula_weight 19849.129 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-terminal Domain, residues 276-437' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Eukaryotic release factor 1, eRF1, TB3-1, Protein Cl1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKS HFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLD DYLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;SNVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKS HFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLD DYLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 VAL n 1 4 LYS n 1 5 PHE n 1 6 ILE n 1 7 GLN n 1 8 GLU n 1 9 LYS n 1 10 LYS n 1 11 LEU n 1 12 ILE n 1 13 GLY n 1 14 ARG n 1 15 TYR n 1 16 PHE n 1 17 ASP n 1 18 GLU n 1 19 ILE n 1 20 SER n 1 21 GLN n 1 22 ASP n 1 23 THR n 1 24 GLY n 1 25 LYS n 1 26 TYR n 1 27 CYS n 1 28 PHE n 1 29 GLY n 1 30 VAL n 1 31 GLU n 1 32 ASP n 1 33 THR n 1 34 LEU n 1 35 LYS n 1 36 ALA n 1 37 LEU n 1 38 GLU n 1 39 MET n 1 40 GLY n 1 41 ALA n 1 42 VAL n 1 43 GLU n 1 44 ILE n 1 45 LEU n 1 46 ILE n 1 47 VAL n 1 48 TYR n 1 49 GLU n 1 50 ASN n 1 51 LEU n 1 52 ASP n 1 53 ILE n 1 54 MET n 1 55 ARG n 1 56 TYR n 1 57 VAL n 1 58 LEU n 1 59 HIS n 1 60 CYS n 1 61 GLN n 1 62 GLY n 1 63 THR n 1 64 GLU n 1 65 GLU n 1 66 GLU n 1 67 LYS n 1 68 ILE n 1 69 LEU n 1 70 TYR n 1 71 LEU n 1 72 THR n 1 73 PRO n 1 74 GLU n 1 75 GLN n 1 76 GLU n 1 77 LYS n 1 78 ASP n 1 79 LYS n 1 80 SER n 1 81 HIS n 1 82 PHE n 1 83 THR n 1 84 ASP n 1 85 LYS n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 GLN n 1 90 GLU n 1 91 HIS n 1 92 GLU n 1 93 LEU n 1 94 ILE n 1 95 GLU n 1 96 SER n 1 97 MET n 1 98 PRO n 1 99 LEU n 1 100 LEU n 1 101 GLU n 1 102 TRP n 1 103 PHE n 1 104 ALA n 1 105 ASN n 1 106 ASN n 1 107 TYR n 1 108 LYS n 1 109 LYS n 1 110 PHE n 1 111 GLY n 1 112 ALA n 1 113 THR n 1 114 LEU n 1 115 GLU n 1 116 ILE n 1 117 VAL n 1 118 THR n 1 119 ASP n 1 120 LYS n 1 121 SER n 1 122 GLN n 1 123 GLU n 1 124 GLY n 1 125 SER n 1 126 GLN n 1 127 PHE n 1 128 VAL n 1 129 LYS n 1 130 GLY n 1 131 PHE n 1 132 GLY n 1 133 GLY n 1 134 ILE n 1 135 GLY n 1 136 GLY n 1 137 ILE n 1 138 LEU n 1 139 ARG n 1 140 TYR n 1 141 ARG n 1 142 VAL n 1 143 ASP n 1 144 PHE n 1 145 GLN n 1 146 GLY n 1 147 MET n 1 148 GLU n 1 149 TYR n 1 150 GLN n 1 151 GLY n 1 152 GLY n 1 153 ASP n 1 154 ASP n 1 155 GLU n 1 156 PHE n 1 157 PHE n 1 158 ASP n 1 159 LEU n 1 160 ASP n 1 161 ASP n 1 162 TYR n 1 163 LEU n 1 164 GLU n 1 165 HIS n 1 166 HIS n 1 167 HIS n 1 168 HIS n 1 169 HIS n 1 170 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ETF1, ERF1, RF1, SUP45L1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET23b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 276 ? ? ? A . n A 1 2 ASN 2 277 277 ASN ASN A . n A 1 3 VAL 3 278 278 VAL VAL A . n A 1 4 LYS 4 279 279 LYS LYS A . n A 1 5 PHE 5 280 280 PHE PHE A . n A 1 6 ILE 6 281 281 ILE ILE A . n A 1 7 GLN 7 282 282 GLN GLN A . n A 1 8 GLU 8 283 283 GLU GLU A . n A 1 9 LYS 9 284 284 LYS LYS A . n A 1 10 LYS 10 285 285 LYS LYS A . n A 1 11 LEU 11 286 286 LEU LEU A . n A 1 12 ILE 12 287 287 ILE ILE A . n A 1 13 GLY 13 288 288 GLY GLY A . n A 1 14 ARG 14 289 289 ARG ARG A . n A 1 15 TYR 15 290 290 TYR TYR A . n A 1 16 PHE 16 291 291 PHE PHE A . n A 1 17 ASP 17 292 292 ASP ASP A . n A 1 18 GLU 18 293 293 GLU GLU A . n A 1 19 ILE 19 294 294 ILE ILE A . n A 1 20 SER 20 295 295 SER SER A . n A 1 21 GLN 21 296 296 GLN GLN A . n A 1 22 ASP 22 297 297 ASP ASP A . n A 1 23 THR 23 298 298 THR THR A . n A 1 24 GLY 24 299 299 GLY GLY A . n A 1 25 LYS 25 300 300 LYS LYS A . n A 1 26 TYR 26 301 301 TYR TYR A . n A 1 27 CYS 27 302 302 CYS CYS A . n A 1 28 PHE 28 303 303 PHE PHE A . n A 1 29 GLY 29 304 304 GLY GLY A . n A 1 30 VAL 30 305 305 VAL VAL A . n A 1 31 GLU 31 306 306 GLU GLU A . n A 1 32 ASP 32 307 307 ASP ASP A . n A 1 33 THR 33 308 308 THR THR A . n A 1 34 LEU 34 309 309 LEU LEU A . n A 1 35 LYS 35 310 310 LYS LYS A . n A 1 36 ALA 36 311 311 ALA ALA A . n A 1 37 LEU 37 312 312 LEU LEU A . n A 1 38 GLU 38 313 313 GLU GLU A . n A 1 39 MET 39 314 314 MET MET A . n A 1 40 GLY 40 315 315 GLY GLY A . n A 1 41 ALA 41 316 316 ALA ALA A . n A 1 42 VAL 42 317 317 VAL VAL A . n A 1 43 GLU 43 318 318 GLU GLU A . n A 1 44 ILE 44 319 319 ILE ILE A . n A 1 45 LEU 45 320 320 LEU LEU A . n A 1 46 ILE 46 321 321 ILE ILE A . n A 1 47 VAL 47 322 322 VAL VAL A . n A 1 48 TYR 48 323 323 TYR TYR A . n A 1 49 GLU 49 324 324 GLU GLU A . n A 1 50 ASN 50 325 325 ASN ASN A . n A 1 51 LEU 51 326 326 LEU LEU A . n A 1 52 ASP 52 327 327 ASP ASP A . n A 1 53 ILE 53 328 328 ILE ILE A . n A 1 54 MET 54 329 329 MET MET A . n A 1 55 ARG 55 330 330 ARG ARG A . n A 1 56 TYR 56 331 331 TYR TYR A . n A 1 57 VAL 57 332 332 VAL VAL A . n A 1 58 LEU 58 333 333 LEU LEU A . n A 1 59 HIS 59 334 334 HIS HIS A . n A 1 60 CYS 60 335 335 CYS CYS A . n A 1 61 GLN 61 336 336 GLN GLN A . n A 1 62 GLY 62 337 337 GLY GLY A . n A 1 63 THR 63 338 338 THR THR A . n A 1 64 GLU 64 339 339 GLU GLU A . n A 1 65 GLU 65 340 340 GLU GLU A . n A 1 66 GLU 66 341 341 GLU GLU A . n A 1 67 LYS 67 342 342 LYS LYS A . n A 1 68 ILE 68 343 343 ILE ILE A . n A 1 69 LEU 69 344 344 LEU LEU A . n A 1 70 TYR 70 345 345 TYR TYR A . n A 1 71 LEU 71 346 346 LEU LEU A . n A 1 72 THR 72 347 347 THR THR A . n A 1 73 PRO 73 348 348 PRO PRO A . n A 1 74 GLU 74 349 349 GLU GLU A . n A 1 75 GLN 75 350 350 GLN GLN A . n A 1 76 GLU 76 351 351 GLU GLU A . n A 1 77 LYS 77 352 352 LYS LYS A . n A 1 78 ASP 78 353 353 ASP ASP A . n A 1 79 LYS 79 354 354 LYS LYS A . n A 1 80 SER 80 355 355 SER SER A . n A 1 81 HIS 81 356 356 HIS HIS A . n A 1 82 PHE 82 357 357 PHE PHE A . n A 1 83 THR 83 358 358 THR THR A . n A 1 84 ASP 84 359 359 ASP ASP A . n A 1 85 LYS 85 360 360 LYS LYS A . n A 1 86 GLU 86 361 361 GLU GLU A . n A 1 87 THR 87 362 362 THR THR A . n A 1 88 GLY 88 363 363 GLY GLY A . n A 1 89 GLN 89 364 364 GLN GLN A . n A 1 90 GLU 90 365 365 GLU GLU A . n A 1 91 HIS 91 366 366 HIS HIS A . n A 1 92 GLU 92 367 367 GLU GLU A . n A 1 93 LEU 93 368 368 LEU LEU A . n A 1 94 ILE 94 369 369 ILE ILE A . n A 1 95 GLU 95 370 370 GLU GLU A . n A 1 96 SER 96 371 371 SER SER A . n A 1 97 MET 97 372 372 MET MET A . n A 1 98 PRO 98 373 373 PRO PRO A . n A 1 99 LEU 99 374 374 LEU LEU A . n A 1 100 LEU 100 375 375 LEU LEU A . n A 1 101 GLU 101 376 376 GLU GLU A . n A 1 102 TRP 102 377 377 TRP TRP A . n A 1 103 PHE 103 378 378 PHE PHE A . n A 1 104 ALA 104 379 379 ALA ALA A . n A 1 105 ASN 105 380 380 ASN ASN A . n A 1 106 ASN 106 381 381 ASN ASN A . n A 1 107 TYR 107 382 382 TYR TYR A . n A 1 108 LYS 108 383 383 LYS LYS A . n A 1 109 LYS 109 384 384 LYS LYS A . n A 1 110 PHE 110 385 385 PHE PHE A . n A 1 111 GLY 111 386 386 GLY GLY A . n A 1 112 ALA 112 387 387 ALA ALA A . n A 1 113 THR 113 388 388 THR THR A . n A 1 114 LEU 114 389 389 LEU LEU A . n A 1 115 GLU 115 390 390 GLU GLU A . n A 1 116 ILE 116 391 391 ILE ILE A . n A 1 117 VAL 117 392 392 VAL VAL A . n A 1 118 THR 118 393 393 THR THR A . n A 1 119 ASP 119 394 394 ASP ASP A . n A 1 120 LYS 120 395 395 LYS LYS A . n A 1 121 SER 121 396 396 SER SER A . n A 1 122 GLN 122 397 397 GLN GLN A . n A 1 123 GLU 123 398 398 GLU GLU A . n A 1 124 GLY 124 399 399 GLY GLY A . n A 1 125 SER 125 400 400 SER SER A . n A 1 126 GLN 126 401 401 GLN GLN A . n A 1 127 PHE 127 402 402 PHE PHE A . n A 1 128 VAL 128 403 403 VAL VAL A . n A 1 129 LYS 129 404 404 LYS LYS A . n A 1 130 GLY 130 405 405 GLY GLY A . n A 1 131 PHE 131 406 406 PHE PHE A . n A 1 132 GLY 132 407 407 GLY GLY A . n A 1 133 GLY 133 408 408 GLY GLY A . n A 1 134 ILE 134 409 409 ILE ILE A . n A 1 135 GLY 135 410 410 GLY GLY A . n A 1 136 GLY 136 411 411 GLY GLY A . n A 1 137 ILE 137 412 412 ILE ILE A . n A 1 138 LEU 138 413 413 LEU LEU A . n A 1 139 ARG 139 414 414 ARG ARG A . n A 1 140 TYR 140 415 415 TYR TYR A . n A 1 141 ARG 141 416 416 ARG ARG A . n A 1 142 VAL 142 417 417 VAL VAL A . n A 1 143 ASP 143 418 418 ASP ASP A . n A 1 144 PHE 144 419 419 PHE PHE A . n A 1 145 GLN 145 420 420 GLN GLN A . n A 1 146 GLY 146 421 421 GLY GLY A . n A 1 147 MET 147 422 422 MET MET A . n A 1 148 GLU 148 423 423 GLU GLU A . n A 1 149 TYR 149 424 424 TYR TYR A . n A 1 150 GLN 150 425 425 GLN GLN A . n A 1 151 GLY 151 426 426 GLY GLY A . n A 1 152 GLY 152 427 427 GLY GLY A . n A 1 153 ASP 153 428 428 ASP ASP A . n A 1 154 ASP 154 429 429 ASP ASP A . n A 1 155 GLU 155 430 430 GLU GLU A . n A 1 156 PHE 156 431 431 PHE PHE A . n A 1 157 PHE 157 432 432 PHE PHE A . n A 1 158 ASP 158 433 433 ASP ASP A . n A 1 159 LEU 159 434 434 LEU LEU A . n A 1 160 ASP 160 435 435 ASP ASP A . n A 1 161 ASP 161 436 436 ASP ASP A . n A 1 162 TYR 162 437 437 TYR TYR A . n A 1 163 LEU 163 438 438 LEU LEU A . n A 1 164 GLU 164 439 439 GLU GLU A . n A 1 165 HIS 165 440 440 HIS HIS A . n A 1 166 HIS 166 441 ? ? ? A . n A 1 167 HIS 167 442 ? ? ? A . n A 1 168 HIS 168 443 ? ? ? A . n A 1 169 HIS 169 444 ? ? ? A . n A 1 170 HIS 170 445 ? ? ? A . n # _cell.entry_id 2KTV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KTV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2KTV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2KTV _struct.title ;Human eRF1 C-domain, "open" conformer ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KTV _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'TRANSLATION, eRF1, C domain, termination, Eukaryotes, Protein biosynthesis' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ERF1_HUMAN _struct_ref.pdbx_db_accession P62495 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SNVKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKS HFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLD DY ; _struct_ref.pdbx_align_begin 276 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KTV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62495 _struct_ref_seq.db_align_beg 276 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 437 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 276 _struct_ref_seq.pdbx_auth_seq_align_end 437 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KTV LEU A 163 ? UNP P62495 ? ? 'expression tag' 438 1 1 2KTV GLU A 164 ? UNP P62495 ? ? 'expression tag' 439 2 1 2KTV HIS A 165 ? UNP P62495 ? ? 'expression tag' 440 3 1 2KTV HIS A 166 ? UNP P62495 ? ? 'expression tag' 441 4 1 2KTV HIS A 167 ? UNP P62495 ? ? 'expression tag' 442 5 1 2KTV HIS A 168 ? UNP P62495 ? ? 'expression tag' 443 6 1 2KTV HIS A 169 ? UNP P62495 ? ? 'expression tag' 444 7 1 2KTV HIS A 170 ? UNP P62495 ? ? 'expression tag' 445 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 2 ? SER A 20 ? ASN A 277 SER A 295 1 ? 19 HELX_P HELX_P2 2 GLY A 29 ? MET A 39 ? GLY A 304 MET A 314 1 ? 11 HELX_P HELX_P3 3 THR A 72 ? LYS A 79 ? THR A 347 LYS A 354 1 ? 8 HELX_P HELX_P4 4 PRO A 98 ? GLY A 111 ? PRO A 373 GLY A 386 1 ? 14 HELX_P HELX_P5 5 SER A 121 ? LYS A 129 ? SER A 396 LYS A 404 1 ? 9 HELX_P HELX_P6 6 TYR A 149 ? ASP A 154 ? TYR A 424 ASP A 429 1 ? 6 HELX_P HELX_P7 7 LEU A 159 ? HIS A 165 ? LEU A 434 HIS A 440 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 26 ? PHE A 28 ? TYR A 301 PHE A 303 A 2 ILE A 134 ? LEU A 138 ? ILE A 409 LEU A 413 A 3 VAL A 42 ? TYR A 48 ? VAL A 317 TYR A 323 A 4 THR A 113 ? VAL A 117 ? THR A 388 VAL A 392 B 1 LYS A 67 ? LEU A 71 ? LYS A 342 LEU A 346 B 2 MET A 54 ? HIS A 59 ? MET A 329 HIS A 334 B 3 GLU A 92 ? MET A 97 ? GLU A 367 MET A 372 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 27 ? N CYS A 302 O GLY A 136 ? O GLY A 411 A 2 3 O GLY A 135 ? O GLY A 410 N ILE A 46 ? N ILE A 321 A 3 4 N LEU A 45 ? N LEU A 320 O THR A 113 ? O THR A 388 B 1 2 O LYS A 67 ? O LYS A 342 N LEU A 58 ? N LEU A 333 B 2 3 N ARG A 55 ? N ARG A 330 O MET A 97 ? O MET A 372 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 300 ? ? H A LEU 413 ? ? 1.53 2 1 O A VAL 278 ? ? H A GLN 282 ? ? 1.54 3 1 H A GLY 304 ? ? O A ILE 409 ? ? 1.55 4 2 O A VAL 278 ? ? H A GLN 282 ? ? 1.54 5 2 O A CYS 302 ? ? H A GLY 411 ? ? 1.57 6 2 H A GLY 304 ? ? O A ILE 409 ? ? 1.59 7 3 O A LYS 300 ? ? H A LEU 413 ? ? 1.56 8 3 H A GLY 304 ? ? O A ILE 409 ? ? 1.57 9 3 O A VAL 278 ? ? H A GLN 282 ? ? 1.57 10 4 O A LYS 300 ? ? H A LEU 413 ? ? 1.44 11 4 O A VAL 278 ? ? H A GLN 282 ? ? 1.53 12 4 H A GLY 304 ? ? O A ILE 409 ? ? 1.59 13 4 H A CYS 302 ? ? O A GLY 411 ? ? 1.60 14 5 O A VAL 278 ? ? H A GLN 282 ? ? 1.55 15 6 H A GLY 304 ? ? O A ILE 409 ? ? 1.56 16 6 O A VAL 278 ? ? H A GLN 282 ? ? 1.56 17 6 O A LYS 300 ? ? H A LEU 413 ? ? 1.57 18 6 H A GLU 318 ? ? O A ILE 412 ? ? 1.58 19 7 O A VAL 278 ? ? H A GLN 282 ? ? 1.55 20 7 O A CYS 302 ? ? H A GLY 411 ? ? 1.58 21 7 O A LEU 333 ? ? H A LYS 342 ? ? 1.60 22 8 O A GLY 304 ? ? HG1 A THR 308 ? ? 1.57 23 8 O A PHE 402 ? ? H A PHE 406 ? ? 1.58 24 9 O A VAL 278 ? ? H A GLN 282 ? ? 1.52 25 9 H A GLY 304 ? ? O A ILE 409 ? ? 1.58 26 10 H A GLY 304 ? ? O A ILE 409 ? ? 1.52 27 10 O A LYS 300 ? ? H A LEU 413 ? ? 1.55 28 10 O A VAL 278 ? ? H A GLN 282 ? ? 1.56 29 10 O A CYS 302 ? ? H A GLY 411 ? ? 1.58 30 11 H A GLU 318 ? ? O A ILE 412 ? ? 1.54 31 11 O A VAL 278 ? ? H A GLN 282 ? ? 1.58 32 11 H A GLY 304 ? ? O A ILE 409 ? ? 1.58 33 12 H A GLY 304 ? ? O A ILE 409 ? ? 1.56 34 12 O A VAL 278 ? ? H A GLN 282 ? ? 1.57 35 12 O A LYS 300 ? ? H A LEU 413 ? ? 1.58 36 13 H A GLY 304 ? ? O A ILE 409 ? ? 1.54 37 13 O A VAL 278 ? ? H A GLN 282 ? ? 1.57 38 14 O A LYS 300 ? ? H A LEU 413 ? ? 1.52 39 14 H A GLY 304 ? ? O A ILE 409 ? ? 1.54 40 14 O A VAL 278 ? ? H A GLN 282 ? ? 1.58 41 15 H A GLY 304 ? ? O A ILE 409 ? ? 1.55 42 15 O A VAL 278 ? ? H A GLN 282 ? ? 1.59 43 16 H A GLU 318 ? ? O A ILE 412 ? ? 1.54 44 16 H A GLY 304 ? ? O A ILE 409 ? ? 1.56 45 16 O A VAL 278 ? ? H A GLN 282 ? ? 1.56 46 17 H A GLY 304 ? ? O A ILE 409 ? ? 1.56 47 18 H A GLY 304 ? ? O A ILE 409 ? ? 1.52 48 18 O A LYS 300 ? ? H A LEU 413 ? ? 1.54 49 18 O A VAL 278 ? ? H A GLN 282 ? ? 1.57 50 19 O A VAL 278 ? ? H A GLN 282 ? ? 1.55 51 20 O A VAL 278 ? ? H A GLN 282 ? ? 1.57 52 20 O A LEU 333 ? ? H A LYS 342 ? ? 1.59 53 21 O A LYS 300 ? ? H A LEU 413 ? ? 1.53 54 21 O A VAL 278 ? ? H A GLN 282 ? ? 1.54 55 21 H A GLY 304 ? ? O A ILE 409 ? ? 1.60 56 22 O A VAL 278 ? ? H A GLN 282 ? ? 1.56 57 22 H A GLY 304 ? ? O A ILE 409 ? ? 1.57 58 22 O A CYS 302 ? ? H A GLY 411 ? ? 1.58 59 22 H A CYS 302 ? ? O A GLY 411 ? ? 1.60 60 23 O A VAL 278 ? ? H A GLN 282 ? ? 1.55 61 24 O A VAL 278 ? ? H A GLN 282 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 325 ? ? -93.22 58.38 2 1 THR A 338 ? ? 48.06 28.27 3 1 GLU A 340 ? ? -164.67 84.72 4 1 LYS A 354 ? ? 68.47 -7.64 5 1 THR A 362 ? ? -137.44 -36.36 6 1 PRO A 373 ? ? -59.85 105.40 7 1 PHE A 406 ? ? -127.63 -90.76 8 2 THR A 362 ? ? -137.40 -37.63 9 2 PRO A 373 ? ? -59.87 106.74 10 2 PHE A 406 ? ? -130.03 -90.03 11 2 VAL A 417 ? ? -176.92 79.57 12 2 PHE A 419 ? ? -172.37 32.14 13 3 THR A 338 ? ? -161.98 16.60 14 3 THR A 362 ? ? -137.23 -36.70 15 3 PRO A 373 ? ? -57.19 103.15 16 3 PHE A 406 ? ? -129.94 -90.19 17 4 LYS A 300 ? ? 81.29 17.41 18 4 LYS A 354 ? ? 74.78 -17.88 19 4 THR A 362 ? ? -136.62 -36.82 20 4 HIS A 366 ? ? -55.93 172.73 21 4 PHE A 406 ? ? -139.20 -89.03 22 4 VAL A 417 ? ? -179.98 83.19 23 5 THR A 362 ? ? -135.14 -38.76 24 5 HIS A 366 ? ? -58.93 172.60 25 5 PRO A 373 ? ? -59.14 104.18 26 5 PHE A 406 ? ? -134.78 -90.24 27 5 ASP A 418 ? ? -89.92 -80.03 28 5 PHE A 419 ? ? 179.41 119.34 29 6 THR A 362 ? ? -137.62 -36.34 30 6 PRO A 373 ? ? -59.56 106.66 31 6 PHE A 406 ? ? -133.43 -90.83 32 7 THR A 338 ? ? -162.11 16.39 33 7 LYS A 354 ? ? 71.05 -3.61 34 7 THR A 362 ? ? -136.73 -37.68 35 7 PRO A 373 ? ? -58.96 106.57 36 7 PHE A 406 ? ? -127.84 -90.04 37 8 LYS A 300 ? ? 74.90 44.44 38 8 THR A 338 ? ? 49.42 27.11 39 8 GLU A 340 ? ? -172.29 100.36 40 8 THR A 362 ? ? -137.53 -36.87 41 8 PHE A 406 ? ? -119.14 -91.15 42 8 TYR A 415 ? ? -163.26 -81.37 43 9 THR A 362 ? ? -137.57 -36.19 44 9 PRO A 373 ? ? -58.12 105.72 45 9 PHE A 406 ? ? -135.38 -90.60 46 9 GLN A 420 ? ? 56.28 85.15 47 10 LYS A 300 ? ? -98.98 34.07 48 10 GLU A 340 ? ? -161.81 106.88 49 10 THR A 362 ? ? -137.78 -34.98 50 10 PRO A 373 ? ? -58.54 104.78 51 10 PHE A 406 ? ? -130.77 -90.39 52 10 VAL A 417 ? ? -171.37 89.18 53 11 LYS A 300 ? ? 80.64 22.13 54 11 THR A 362 ? ? -137.76 -34.86 55 11 PHE A 406 ? ? -129.99 -90.95 56 11 TYR A 415 ? ? -155.29 -81.10 57 12 ASN A 325 ? ? -91.61 56.80 58 12 THR A 338 ? ? -152.55 3.17 59 12 THR A 362 ? ? -137.34 -38.72 60 12 PRO A 373 ? ? -59.88 102.50 61 12 PHE A 406 ? ? -146.56 -79.00 62 12 ASP A 418 ? ? -89.96 -80.02 63 13 THR A 338 ? ? 46.24 29.25 64 13 GLU A 340 ? ? -151.75 85.42 65 13 LYS A 354 ? ? 70.29 -13.79 66 13 THR A 362 ? ? -137.58 -37.28 67 13 PHE A 406 ? ? -129.97 -89.95 68 14 LYS A 300 ? ? 75.42 42.19 69 14 TYR A 301 ? ? -175.29 136.66 70 14 ASN A 325 ? ? -93.37 57.71 71 14 THR A 338 ? ? 48.30 27.86 72 14 GLU A 340 ? ? -166.63 87.57 73 14 THR A 362 ? ? -137.98 -34.67 74 14 PHE A 406 ? ? -115.90 -90.85 75 14 ASP A 418 ? ? -90.36 -75.28 76 15 ASN A 325 ? ? -94.39 58.75 77 15 THR A 338 ? ? -153.01 6.30 78 15 LYS A 354 ? ? 68.83 -5.42 79 15 THR A 362 ? ? -137.41 -36.14 80 15 HIS A 366 ? ? -57.03 175.58 81 15 PHE A 406 ? ? -131.47 -89.99 82 15 ASP A 418 ? ? -89.96 -78.41 83 16 LYS A 300 ? ? 85.64 40.27 84 16 TYR A 301 ? ? -174.17 144.08 85 16 THR A 338 ? ? -158.19 16.27 86 16 LYS A 354 ? ? 69.37 -1.40 87 16 THR A 362 ? ? -137.96 -35.28 88 16 PRO A 373 ? ? -59.24 105.70 89 16 PHE A 406 ? ? -132.31 -91.81 90 17 THR A 338 ? ? -155.14 9.94 91 17 LYS A 354 ? ? 72.04 -14.06 92 17 THR A 362 ? ? -137.51 -37.00 93 17 PHE A 406 ? ? -129.91 -90.71 94 18 GLU A 340 ? ? -165.56 108.54 95 18 THR A 362 ? ? -136.71 -38.25 96 18 PRO A 373 ? ? -59.98 105.60 97 18 PHE A 406 ? ? -130.05 -89.92 98 19 THR A 338 ? ? 48.73 25.35 99 19 GLU A 340 ? ? -163.42 96.78 100 19 THR A 362 ? ? -137.13 -35.97 101 19 PRO A 373 ? ? -59.34 104.61 102 19 PHE A 406 ? ? -130.05 -91.75 103 20 ASN A 325 ? ? -98.56 58.87 104 20 THR A 338 ? ? -156.90 3.34 105 20 THR A 362 ? ? -137.59 -36.51 106 20 PRO A 373 ? ? -57.85 105.05 107 20 PHE A 406 ? ? -134.51 -91.64 108 20 ARG A 416 ? ? -71.35 25.25 109 20 VAL A 417 ? ? -66.53 78.98 110 21 TYR A 301 ? ? -176.82 148.47 111 21 THR A 338 ? ? 44.86 27.06 112 21 GLU A 340 ? ? -165.96 89.98 113 21 LYS A 354 ? ? 67.48 -9.47 114 21 THR A 362 ? ? -137.53 -37.61 115 21 HIS A 366 ? ? -55.21 179.63 116 21 PRO A 373 ? ? -59.92 106.89 117 21 PHE A 406 ? ? -121.88 -91.36 118 21 TYR A 415 ? ? -167.94 -170.00 119 22 LYS A 300 ? ? 37.27 32.72 120 22 ASN A 325 ? ? -91.42 56.49 121 22 THR A 362 ? ? -136.38 -36.18 122 22 PRO A 373 ? ? -59.85 103.08 123 22 PHE A 406 ? ? -135.43 -90.39 124 23 THR A 338 ? ? 49.92 23.23 125 23 LYS A 354 ? ? 71.47 -16.94 126 23 THR A 362 ? ? -135.55 -38.96 127 23 HIS A 366 ? ? -55.83 179.14 128 23 PRO A 373 ? ? -59.19 103.18 129 23 PHE A 406 ? ? -132.77 -86.10 130 23 ASP A 418 ? ? -89.97 -80.00 131 24 ASN A 325 ? ? -94.71 58.83 132 24 GLN A 336 ? ? 49.66 -147.87 133 24 LYS A 354 ? ? 70.39 -3.10 134 24 THR A 362 ? ? -137.59 -39.56 135 24 PRO A 373 ? ? -56.49 102.41 136 24 PHE A 406 ? ? -130.38 -90.61 137 24 ASP A 428 ? ? -90.40 32.02 # _pdbx_nmr_ensemble.entry_id 2KTV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 24 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.017 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.001 _pdbx_nmr_ensemble_rms.entry_id 2KTV _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.entry_id 2KTV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1 MM C_ERF1_HUMAN, 50 MM POTASSIUM CHLORIDE, 10 MM POTASSIUM PHOSPHATE, 90% H2O/10% D2O' '90% H2O/10% D2O' sample_1 solution ? 2 '0.8 MM [U-99% 15N] C_ERF1_HUMAN, 50 MM POTASSIUM CHLORIDE, 10 MM POTASSIUM PHOSPHATE, 90% H2O/10% D2O' '90% H2O/10% D2O' sample_2 solution ? 3 '0.8 MM [U-99% 13C U-99% 15N] C_ERF1_HUMAN, 50 MM POTASSIUM CHLORIDE, 10 MM POTASSIUM PHOSPHATE, 90% H2O/10% D2O' '90% H2O/10% D2O' sample_3 solution ? 4 '0.8 MM [U-99% 13C U-99% 15N] C_ERF1_HUMAN, 50 MM POTASSIUM CHLORIDE, 10 MM POTASSIUM PHOSPHATE, 100% D2O' '90% H2O/10% D2O' sample_4 solution ? 5 '1 MM C_ERF1_ HUMAN, 50 MM POTASSIUM CHLORIDE, 10 MM POTASSIUM PHOSPHATE, 5 % DMPC/DHPC/ SDS, 90% H2O/10% D2O' '90% H2O/10% D2O' sample_5 bicelle ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id C_ERF1_HUMAN 1 ? mM 'natural abundance' 1 'potassium chloride' 50 ? mM 'natural abundance' 1 'potassium phosphate' 10 ? mM 'natural abundance' 1 C_ERF1_HUMAN 0.8 ? mM '[U-99% 15N]' 2 'potassium chloride' 50 ? mM 'natural abundance' 2 'potassium phosphate' 10 ? mM 'natural abundance' 2 C_ERF1_HUMAN 0.8 ? mM '[U-99% 13C; U-99% 15N]' 3 'potassium chloride' 50 ? mM 'natural abundance' 3 'potassium phosphate' 10 ? mM 'natural abundance' 3 C_ERF1_HUMAN 0.8 ? mM '[U-99% 13C; U-99% 15N]' 4 'potassium chloride' 50 ? mM 'natural abundance' 4 'potassium phosphate' 10 ? mM 'natural abundance' 4 C_ERF1_HUMAN 1 ? mM 'natural abundance' 5 'potassium chloride' 50 ? mM 'natural abundance' 5 'potassium phosphate' 10 ? mM 'natural abundance' 5 DMPC/DHPC/SDS 5 ? % 'natural abundance' 5 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.temperature_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 1 298 ? AMBIENT 7.0 0.08 K ? ? ? 2 311 ? AMBIENT 7.0 0.08 K ? ? ? # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D DQF-COSY' 1 2 1 '2D 1H-15N HSQC' 2 3 1 '3D HNCA' 3 4 1 '3D HNCACB' 3 5 1 '3D HN(CO)CA' 3 6 1 '3D CBCA(CO)NH' 3 7 1 '3D HBHA(CO)NH' 3 8 1 '3D HNCO' 3 9 1 '3D HNHA' 3 10 1 '3D 1H-15N NOESY' 3 11 1 '3D 1H-13C NOESY' 3 12 1 '3D HCCH-TOCSY' 3 13 1 '3D HNCA' 4 14 1 '3D HNCACB' 4 15 1 '3D HN(CO)CA' 4 16 1 '3D CBCA(CO)NH' 4 17 1 '3D HBHA(CO)NH' 4 18 1 '3D HNCO' 4 19 1 '3D HNHA' 4 20 1 '3D 1H-15N NOESY' 4 21 1 '3D 1H-13C NOESY' 4 22 1 '3D HCCH-TOCSY' 4 23 1 '2D 1H-13C HSQC' 5 24 2 '3D 1H-15N NOESY' 3 25 2 '3D 1H-13C NOESY' 3 26 2 '3D 1H-15N NOESY' 4 27 2 '3D 1H-13C NOESY' 4 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KTV _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 108 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 108 # _pdbx_nmr_refine.entry_id 2KTV _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 2.1 'BRUNGER, ADAMS, CLORE, DELANO, GROS, GROSSE- KUNSTLEVE, JIANG, KUSZEWSKI, NILGES, PANNU, READ, RICE, SIMONSON, WARREN' 1 collection VNMR ? Varian 2 collection TopSpin ? 'Bruker Biospin' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'structure solution' Sparky ? Goddard 5 'data analysis' TALOS ? 'Cornilescu, Delaglio and Bax' 6 'data analysis' Anglesearch 2.10 'Polshakov VI & Feeney J.' 7 'structure solution' CNS 2.1 'BRUNGER, ADAMS, CLORE, DELANO, GROS, GROSSE- KUNSTLEVE, JIANG, KUSZEWSKI, NILGES, PANNU, READ, RICE, SIMONSON, WARREN' 8 'structure solution' ARIA ? ;Linge, O'Donoghue and Nilges ; 9 'structure solution' CNSSOLVE ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 10 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 276 ? A SER 1 2 1 Y 1 A HIS 441 ? A HIS 166 3 1 Y 1 A HIS 442 ? A HIS 167 4 1 Y 1 A HIS 443 ? A HIS 168 5 1 Y 1 A HIS 444 ? A HIS 169 6 1 Y 1 A HIS 445 ? A HIS 170 7 2 Y 1 A SER 276 ? A SER 1 8 2 Y 1 A HIS 441 ? A HIS 166 9 2 Y 1 A HIS 442 ? A HIS 167 10 2 Y 1 A HIS 443 ? A HIS 168 11 2 Y 1 A HIS 444 ? A HIS 169 12 2 Y 1 A HIS 445 ? A HIS 170 13 3 Y 1 A SER 276 ? A SER 1 14 3 Y 1 A HIS 441 ? A HIS 166 15 3 Y 1 A HIS 442 ? A HIS 167 16 3 Y 1 A HIS 443 ? A HIS 168 17 3 Y 1 A HIS 444 ? A HIS 169 18 3 Y 1 A HIS 445 ? A HIS 170 19 4 Y 1 A SER 276 ? A SER 1 20 4 Y 1 A HIS 441 ? A HIS 166 21 4 Y 1 A HIS 442 ? A HIS 167 22 4 Y 1 A HIS 443 ? A HIS 168 23 4 Y 1 A HIS 444 ? A HIS 169 24 4 Y 1 A HIS 445 ? A HIS 170 25 5 Y 1 A SER 276 ? A SER 1 26 5 Y 1 A HIS 441 ? A HIS 166 27 5 Y 1 A HIS 442 ? A HIS 167 28 5 Y 1 A HIS 443 ? A HIS 168 29 5 Y 1 A HIS 444 ? A HIS 169 30 5 Y 1 A HIS 445 ? A HIS 170 31 6 Y 1 A SER 276 ? A SER 1 32 6 Y 1 A HIS 441 ? A HIS 166 33 6 Y 1 A HIS 442 ? A HIS 167 34 6 Y 1 A HIS 443 ? A HIS 168 35 6 Y 1 A HIS 444 ? A HIS 169 36 6 Y 1 A HIS 445 ? A HIS 170 37 7 Y 1 A SER 276 ? A SER 1 38 7 Y 1 A HIS 441 ? A HIS 166 39 7 Y 1 A HIS 442 ? A HIS 167 40 7 Y 1 A HIS 443 ? A HIS 168 41 7 Y 1 A HIS 444 ? A HIS 169 42 7 Y 1 A HIS 445 ? A HIS 170 43 8 Y 1 A SER 276 ? A SER 1 44 8 Y 1 A HIS 441 ? A HIS 166 45 8 Y 1 A HIS 442 ? A HIS 167 46 8 Y 1 A HIS 443 ? A HIS 168 47 8 Y 1 A HIS 444 ? A HIS 169 48 8 Y 1 A HIS 445 ? A HIS 170 49 9 Y 1 A SER 276 ? A SER 1 50 9 Y 1 A HIS 441 ? A HIS 166 51 9 Y 1 A HIS 442 ? A HIS 167 52 9 Y 1 A HIS 443 ? A HIS 168 53 9 Y 1 A HIS 444 ? A HIS 169 54 9 Y 1 A HIS 445 ? A HIS 170 55 10 Y 1 A SER 276 ? A SER 1 56 10 Y 1 A HIS 441 ? A HIS 166 57 10 Y 1 A HIS 442 ? A HIS 167 58 10 Y 1 A HIS 443 ? A HIS 168 59 10 Y 1 A HIS 444 ? A HIS 169 60 10 Y 1 A HIS 445 ? A HIS 170 61 11 Y 1 A SER 276 ? A SER 1 62 11 Y 1 A HIS 441 ? A HIS 166 63 11 Y 1 A HIS 442 ? A HIS 167 64 11 Y 1 A HIS 443 ? A HIS 168 65 11 Y 1 A HIS 444 ? A HIS 169 66 11 Y 1 A HIS 445 ? A HIS 170 67 12 Y 1 A SER 276 ? A SER 1 68 12 Y 1 A HIS 441 ? A HIS 166 69 12 Y 1 A HIS 442 ? A HIS 167 70 12 Y 1 A HIS 443 ? A HIS 168 71 12 Y 1 A HIS 444 ? A HIS 169 72 12 Y 1 A HIS 445 ? A HIS 170 73 13 Y 1 A SER 276 ? A SER 1 74 13 Y 1 A HIS 441 ? A HIS 166 75 13 Y 1 A HIS 442 ? A HIS 167 76 13 Y 1 A HIS 443 ? A HIS 168 77 13 Y 1 A HIS 444 ? A HIS 169 78 13 Y 1 A HIS 445 ? A HIS 170 79 14 Y 1 A SER 276 ? A SER 1 80 14 Y 1 A HIS 441 ? A HIS 166 81 14 Y 1 A HIS 442 ? A HIS 167 82 14 Y 1 A HIS 443 ? A HIS 168 83 14 Y 1 A HIS 444 ? A HIS 169 84 14 Y 1 A HIS 445 ? A HIS 170 85 15 Y 1 A SER 276 ? A SER 1 86 15 Y 1 A HIS 441 ? A HIS 166 87 15 Y 1 A HIS 442 ? A HIS 167 88 15 Y 1 A HIS 443 ? A HIS 168 89 15 Y 1 A HIS 444 ? A HIS 169 90 15 Y 1 A HIS 445 ? A HIS 170 91 16 Y 1 A SER 276 ? A SER 1 92 16 Y 1 A HIS 441 ? A HIS 166 93 16 Y 1 A HIS 442 ? A HIS 167 94 16 Y 1 A HIS 443 ? A HIS 168 95 16 Y 1 A HIS 444 ? A HIS 169 96 16 Y 1 A HIS 445 ? A HIS 170 97 17 Y 1 A SER 276 ? A SER 1 98 17 Y 1 A HIS 441 ? A HIS 166 99 17 Y 1 A HIS 442 ? A HIS 167 100 17 Y 1 A HIS 443 ? A HIS 168 101 17 Y 1 A HIS 444 ? A HIS 169 102 17 Y 1 A HIS 445 ? A HIS 170 103 18 Y 1 A SER 276 ? A SER 1 104 18 Y 1 A HIS 441 ? A HIS 166 105 18 Y 1 A HIS 442 ? A HIS 167 106 18 Y 1 A HIS 443 ? A HIS 168 107 18 Y 1 A HIS 444 ? A HIS 169 108 18 Y 1 A HIS 445 ? A HIS 170 109 19 Y 1 A SER 276 ? A SER 1 110 19 Y 1 A HIS 441 ? A HIS 166 111 19 Y 1 A HIS 442 ? A HIS 167 112 19 Y 1 A HIS 443 ? A HIS 168 113 19 Y 1 A HIS 444 ? A HIS 169 114 19 Y 1 A HIS 445 ? A HIS 170 115 20 Y 1 A SER 276 ? A SER 1 116 20 Y 1 A HIS 441 ? A HIS 166 117 20 Y 1 A HIS 442 ? A HIS 167 118 20 Y 1 A HIS 443 ? A HIS 168 119 20 Y 1 A HIS 444 ? A HIS 169 120 20 Y 1 A HIS 445 ? A HIS 170 121 21 Y 1 A SER 276 ? A SER 1 122 21 Y 1 A HIS 441 ? A HIS 166 123 21 Y 1 A HIS 442 ? A HIS 167 124 21 Y 1 A HIS 443 ? A HIS 168 125 21 Y 1 A HIS 444 ? A HIS 169 126 21 Y 1 A HIS 445 ? A HIS 170 127 22 Y 1 A SER 276 ? A SER 1 128 22 Y 1 A HIS 441 ? A HIS 166 129 22 Y 1 A HIS 442 ? A HIS 167 130 22 Y 1 A HIS 443 ? A HIS 168 131 22 Y 1 A HIS 444 ? A HIS 169 132 22 Y 1 A HIS 445 ? A HIS 170 133 23 Y 1 A SER 276 ? A SER 1 134 23 Y 1 A HIS 441 ? A HIS 166 135 23 Y 1 A HIS 442 ? A HIS 167 136 23 Y 1 A HIS 443 ? A HIS 168 137 23 Y 1 A HIS 444 ? A HIS 169 138 23 Y 1 A HIS 445 ? A HIS 170 139 24 Y 1 A SER 276 ? A SER 1 140 24 Y 1 A HIS 441 ? A HIS 166 141 24 Y 1 A HIS 442 ? A HIS 167 142 24 Y 1 A HIS 443 ? A HIS 168 143 24 Y 1 A HIS 444 ? A HIS 169 144 24 Y 1 A HIS 445 ? A HIS 170 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 600 ? 2 AVANCE Bruker 700 ? 3 INOVA Varian 600 ? 4 INOVA Varian 800 ? # _atom_sites.entry_id 2KTV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_