data_2L2Q # _entry.id 2L2Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L2Q pdb_00002l2q 10.2210/pdb2l2q/pdb RCSB RCSB101882 ? ? WWPDB D_1000101882 ? ? BMRB 17150 ? 10.13018/BMR17150 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-09-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L2Q _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-08-25 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB BobuA.00981.a . unspecified BMRB 17150 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yang, F.' 1 'Barnwal, R.P.' 2 'Varani, G.' 3 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 4 # _citation.id primary _citation.title 'Solution Structure of cellobiose-specific phosphotransferase IIB component protein from Borrelia burgdorferi' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, F.' 1 ? primary 'Barnwal, R.P.' 2 ? primary 'Varani, G.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PTS system, cellobiose-specific IIB component (CelA)' _entity.formula_weight 11980.933 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.69 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPGSMNILLVCGAGMSTSMLVQRIEKYAKSKNINATIEAIAETRLSEVVDRFDVVLLAPQSRFNKKRLEEITKPKGIPIE IINTIDYGTMNGEKVLQLAINAFNNKSSV ; _entity_poly.pdbx_seq_one_letter_code_can ;GPGSMNILLVCGAGMSTSMLVQRIEKYAKSKNINATIEAIAETRLSEVVDRFDVVLLAPQSRFNKKRLEEITKPKGIPIE IINTIDYGTMNGEKVLQLAINAFNNKSSV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BobuA.00981.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 ASN n 1 7 ILE n 1 8 LEU n 1 9 LEU n 1 10 VAL n 1 11 CYS n 1 12 GLY n 1 13 ALA n 1 14 GLY n 1 15 MET n 1 16 SER n 1 17 THR n 1 18 SER n 1 19 MET n 1 20 LEU n 1 21 VAL n 1 22 GLN n 1 23 ARG n 1 24 ILE n 1 25 GLU n 1 26 LYS n 1 27 TYR n 1 28 ALA n 1 29 LYS n 1 30 SER n 1 31 LYS n 1 32 ASN n 1 33 ILE n 1 34 ASN n 1 35 ALA n 1 36 THR n 1 37 ILE n 1 38 GLU n 1 39 ALA n 1 40 ILE n 1 41 ALA n 1 42 GLU n 1 43 THR n 1 44 ARG n 1 45 LEU n 1 46 SER n 1 47 GLU n 1 48 VAL n 1 49 VAL n 1 50 ASP n 1 51 ARG n 1 52 PHE n 1 53 ASP n 1 54 VAL n 1 55 VAL n 1 56 LEU n 1 57 LEU n 1 58 ALA n 1 59 PRO n 1 60 GLN n 1 61 SER n 1 62 ARG n 1 63 PHE n 1 64 ASN n 1 65 LYS n 1 66 LYS n 1 67 ARG n 1 68 LEU n 1 69 GLU n 1 70 GLU n 1 71 ILE n 1 72 THR n 1 73 LYS n 1 74 PRO n 1 75 LYS n 1 76 GLY n 1 77 ILE n 1 78 PRO n 1 79 ILE n 1 80 GLU n 1 81 ILE n 1 82 ILE n 1 83 ASN n 1 84 THR n 1 85 ILE n 1 86 ASP n 1 87 TYR n 1 88 GLY n 1 89 THR n 1 90 MET n 1 91 ASN n 1 92 GLY n 1 93 GLU n 1 94 LYS n 1 95 VAL n 1 96 LEU n 1 97 GLN n 1 98 LEU n 1 99 ALA n 1 100 ILE n 1 101 ASN n 1 102 ALA n 1 103 PHE n 1 104 ASN n 1 105 ASN n 1 106 LYS n 1 107 SER n 1 108 SER n 1 109 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Lyme disease spirochete' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BB_B06 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Borrelia burgdorferi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 139 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'Ava Vector' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 VAL 109 109 109 VAL VAL A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L2Q _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L2Q _struct.title 'Solution Structure of cellobiose-specific phosphotransferase IIB component protein from Borrelia burgdorferi' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L2Q _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;cellobiose-specific phosphotransferase IIB component, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SGC, SSGCID, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O50982_BORBU _struct_ref.pdbx_db_accession O50982 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNILLVCGAGMSTSMLVQRIEKYAKSKNINATIEAIAETRLSEVVDRFDVVLLAPQSRFNKKRLEEITKPKGIPIEIINT IDYGTMNGEKVLQLAINAFNNKSSV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L2Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O50982 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L2Q GLY A 1 ? UNP O50982 ? ? 'expression tag' 1 1 1 2L2Q PRO A 2 ? UNP O50982 ? ? 'expression tag' 2 2 1 2L2Q GLY A 3 ? UNP O50982 ? ? 'expression tag' 3 3 1 2L2Q SER A 4 ? UNP O50982 ? ? 'expression tag' 4 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 18 ? ASN A 32 ? SER A 18 ASN A 32 1 ? 15 HELX_P HELX_P2 2 ARG A 44 ? VAL A 49 ? ARG A 44 VAL A 49 1 ? 6 HELX_P HELX_P3 3 PHE A 63 ? GLY A 76 ? PHE A 63 GLY A 76 1 ? 14 HELX_P HELX_P4 4 ASN A 83 ? MET A 90 ? ASN A 83 MET A 90 1 ? 8 HELX_P HELX_P5 5 ASN A 91 ? LYS A 106 ? ASN A 91 LYS A 106 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 35 ? ILE A 40 ? ALA A 35 ILE A 40 A 2 MET A 5 ? VAL A 10 ? MET A 5 VAL A 10 A 3 VAL A 54 ? LEU A 57 ? VAL A 54 LEU A 57 A 4 ILE A 79 ? ILE A 81 ? ILE A 79 ILE A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 38 ? O GLU A 38 N LEU A 9 ? N LEU A 9 A 2 3 N VAL A 10 ? N VAL A 10 O LEU A 56 ? O LEU A 56 A 3 4 N VAL A 55 ? N VAL A 55 O GLU A 80 ? O GLU A 80 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -69.75 85.75 2 1 CYS A 11 ? ? -171.12 -59.16 3 1 ALA A 13 ? ? -103.47 42.28 4 1 THR A 17 ? ? 63.31 100.32 5 1 ASN A 32 ? ? 63.86 61.52 6 1 PHE A 52 ? ? -57.12 179.15 7 1 GLN A 60 ? ? 60.02 87.12 8 1 PRO A 78 ? ? -69.78 98.41 9 1 MET A 90 ? ? 63.11 60.06 10 1 LYS A 106 ? ? 52.34 72.17 11 2 CYS A 11 ? ? -176.96 -71.71 12 2 MET A 15 ? ? 62.29 172.06 13 2 SER A 16 ? ? 55.51 -170.22 14 2 ASN A 32 ? ? 64.07 61.05 15 2 PHE A 52 ? ? -57.27 179.69 16 2 ASP A 53 ? ? -134.78 -41.41 17 2 GLN A 60 ? ? 59.57 76.94 18 2 MET A 90 ? ? 63.34 62.04 19 3 ALA A 13 ? ? 63.59 172.13 20 3 MET A 15 ? ? -169.76 43.21 21 3 SER A 16 ? ? 61.16 171.34 22 3 THR A 17 ? ? 53.89 90.84 23 3 ASN A 32 ? ? 63.93 61.68 24 3 PRO A 59 ? ? -69.77 78.63 25 3 GLN A 60 ? ? -172.49 82.82 26 3 SER A 61 ? ? -179.40 124.53 27 3 MET A 90 ? ? 60.88 79.02 28 3 SER A 108 ? ? -143.66 46.38 29 4 CYS A 11 ? ? -171.07 99.06 30 4 ASN A 32 ? ? 60.05 63.35 31 4 PHE A 52 ? ? -58.52 175.89 32 4 PRO A 59 ? ? -69.85 -173.10 33 4 SER A 61 ? ? -174.47 113.64 34 4 MET A 90 ? ? 63.19 88.11 35 4 SER A 108 ? ? 62.93 172.18 36 5 PRO A 2 ? ? -69.67 84.38 37 5 CYS A 11 ? ? -177.01 -35.84 38 5 THR A 17 ? ? 51.63 73.60 39 5 ASP A 53 ? ? -98.55 -74.76 40 5 SER A 61 ? ? -179.07 122.15 41 5 ARG A 62 ? ? -91.11 -66.12 42 5 MET A 90 ? ? 63.28 64.42 43 5 SER A 108 ? ? -157.05 87.07 44 6 CYS A 11 ? ? -174.11 -38.15 45 6 THR A 17 ? ? -161.65 -40.26 46 6 SER A 18 ? ? -178.70 69.96 47 6 ASN A 32 ? ? 63.94 61.33 48 6 PHE A 52 ? ? -60.55 -179.44 49 6 ASP A 53 ? ? -99.65 -75.04 50 6 GLN A 60 ? ? -93.94 40.47 51 6 ARG A 62 ? ? -91.22 -66.20 52 6 LYS A 106 ? ? 58.80 -174.16 53 7 SER A 4 ? ? -172.29 147.78 54 7 CYS A 11 ? ? -177.07 -52.00 55 7 THR A 17 ? ? 54.90 79.55 56 7 ASN A 32 ? ? 63.92 60.23 57 7 ALA A 41 ? ? -65.78 -173.98 58 7 ARG A 62 ? ? -91.13 -66.03 59 7 PRO A 78 ? ? -69.83 92.00 60 7 MET A 90 ? ? 63.53 83.39 61 7 LYS A 106 ? ? 58.73 -178.67 62 8 CYS A 11 ? ? -177.06 -70.43 63 8 MET A 15 ? ? -143.64 -46.28 64 8 THR A 17 ? ? 60.89 79.12 65 8 PHE A 52 ? ? -63.88 -178.96 66 8 SER A 61 ? ? 66.46 121.71 67 8 ARG A 62 ? ? -91.40 -66.14 68 8 MET A 90 ? ? 63.24 83.02 69 8 LYS A 106 ? ? 63.00 172.53 70 8 SER A 107 ? ? 72.09 -69.29 71 9 CYS A 11 ? ? -140.46 -42.14 72 9 ALA A 13 ? ? 68.88 -77.39 73 9 MET A 15 ? ? -168.59 91.53 74 9 THR A 17 ? ? -158.06 44.17 75 9 ASN A 32 ? ? 63.98 60.83 76 9 PHE A 52 ? ? -58.05 -178.24 77 9 ASP A 53 ? ? -123.60 -59.28 78 9 ARG A 62 ? ? -91.33 -66.06 79 9 PRO A 78 ? ? -69.76 96.58 80 9 MET A 90 ? ? 63.29 68.06 81 10 MET A 15 ? ? -114.74 73.23 82 10 SER A 16 ? ? 62.91 165.05 83 10 ASN A 32 ? ? 60.03 62.82 84 10 PHE A 52 ? ? -63.84 -179.17 85 10 PRO A 59 ? ? -69.83 77.42 86 10 SER A 61 ? ? 64.40 110.32 87 10 PRO A 78 ? ? -69.72 94.22 88 10 MET A 90 ? ? 63.41 64.45 89 10 LYS A 106 ? ? 63.15 -178.52 90 10 SER A 107 ? ? -102.02 -66.25 91 10 SER A 108 ? ? -175.18 84.29 92 11 SER A 4 ? ? 61.68 175.76 93 11 CYS A 11 ? ? -176.96 113.01 94 11 PRO A 59 ? ? -69.76 88.55 95 11 GLN A 60 ? ? -179.16 -44.48 96 11 SER A 61 ? ? -52.66 106.70 97 11 PRO A 78 ? ? -69.76 99.54 98 11 MET A 90 ? ? 61.71 65.02 99 11 SER A 107 ? ? 60.87 171.28 100 11 SER A 108 ? ? -157.53 80.11 101 12 PRO A 2 ? ? -69.68 -171.73 102 12 MET A 15 ? ? 62.75 168.89 103 12 SER A 16 ? ? 63.04 166.93 104 12 ASN A 32 ? ? 63.96 60.71 105 12 PHE A 52 ? ? -65.38 -177.65 106 12 ASP A 53 ? ? -105.97 -65.26 107 12 PRO A 59 ? ? -69.75 77.41 108 12 GLN A 60 ? ? -179.60 34.41 109 12 ARG A 62 ? ? -91.31 -66.12 110 12 MET A 90 ? ? 63.37 64.13 111 12 LYS A 106 ? ? 54.56 74.61 112 12 SER A 107 ? ? -178.20 114.39 113 13 CYS A 11 ? ? -176.92 -74.05 114 13 ALA A 13 ? ? -114.62 -75.52 115 13 THR A 17 ? ? 46.79 71.52 116 13 PHE A 52 ? ? -58.03 -178.94 117 13 ASP A 53 ? ? -126.62 -57.36 118 13 SER A 61 ? ? -170.49 119.23 119 13 PRO A 78 ? ? -69.83 96.82 120 13 MET A 90 ? ? 61.05 100.51 121 13 SER A 108 ? ? -57.35 108.33 122 14 SER A 4 ? ? 63.04 161.68 123 14 MET A 15 ? ? -176.18 -38.18 124 14 SER A 16 ? ? -66.68 89.80 125 14 PHE A 52 ? ? -55.67 176.68 126 14 ASP A 53 ? ? -109.07 -62.08 127 14 PRO A 59 ? ? -69.78 78.26 128 14 GLN A 60 ? ? -174.93 85.72 129 14 SER A 61 ? ? -179.37 109.82 130 14 PRO A 78 ? ? -69.74 95.44 131 14 LYS A 106 ? ? -80.44 -72.49 132 14 SER A 107 ? ? 61.27 173.23 133 15 SER A 4 ? ? 63.06 175.34 134 15 CYS A 11 ? ? -131.09 -40.49 135 15 SER A 16 ? ? -144.19 -42.67 136 15 THR A 17 ? ? -67.81 88.21 137 15 PHE A 52 ? ? -54.43 173.74 138 15 ARG A 62 ? ? -91.27 -63.57 139 15 PRO A 78 ? ? -69.78 96.60 140 15 MET A 90 ? ? 57.92 71.16 141 15 SER A 107 ? ? -179.27 71.94 142 16 PRO A 2 ? ? -69.80 97.20 143 16 SER A 4 ? ? 62.82 175.28 144 16 CYS A 11 ? ? -171.97 57.83 145 16 ALA A 13 ? ? 62.97 94.18 146 16 THR A 17 ? ? 62.76 88.16 147 16 ARG A 62 ? ? -90.96 -66.01 148 16 PRO A 78 ? ? -69.68 98.44 149 16 MET A 90 ? ? 58.36 72.37 150 16 LYS A 106 ? ? -108.47 77.74 151 17 SER A 4 ? ? 61.40 168.84 152 17 CYS A 11 ? ? -174.52 137.14 153 17 SER A 16 ? ? 63.10 163.48 154 17 PHE A 52 ? ? -52.11 170.60 155 17 ASP A 53 ? ? -95.82 -74.02 156 17 ARG A 62 ? ? -91.37 -66.09 157 17 MET A 90 ? ? 62.37 77.18 158 17 SER A 108 ? ? -164.71 51.92 159 18 ALA A 13 ? ? -151.67 25.34 160 18 MET A 15 ? ? -173.11 47.15 161 18 THR A 17 ? ? 46.74 84.69 162 18 PHE A 52 ? ? -57.28 179.89 163 18 ARG A 62 ? ? -91.21 -66.09 164 18 PRO A 78 ? ? -69.75 95.80 165 18 MET A 90 ? ? 63.22 62.67 166 18 SER A 108 ? ? -169.99 52.63 167 19 CYS A 11 ? ? -166.25 -64.48 168 19 SER A 16 ? ? 69.39 -75.72 169 19 PHE A 52 ? ? -57.44 -179.54 170 19 ASP A 53 ? ? -106.55 -71.08 171 19 ARG A 62 ? ? -91.19 -66.08 172 19 MET A 90 ? ? 63.51 83.68 173 20 ALA A 13 ? ? 54.15 76.37 174 20 MET A 15 ? ? 58.03 -176.47 175 20 ASP A 53 ? ? -95.93 -74.52 176 20 SER A 61 ? ? -179.37 124.42 177 20 ARG A 62 ? ? -91.00 -66.14 178 20 MET A 90 ? ? 63.25 74.57 179 20 LYS A 106 ? ? 39.49 41.53 180 20 SER A 107 ? ? -161.49 -55.38 181 20 SER A 108 ? ? 61.83 99.18 # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L2Q _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L2Q _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.2 mM [U-95% 15N] protein, 20 mM potassium phosphate, 100 mM potassium chloride, 1 mM DTT, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.2 mM [U-95% 13C; U-95% 15N] protein, 20 mM potassium phosphate, 100 mM potassium chloride, 1 mM DTT, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1.1 mM protein, 20 mM potassium phosphate, 100 mM potassium chloride, 1 mM DTT, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 1.2 ? mM '[U-95% 15N]' 1 'potassium phosphate-2' 20 ? mM ? 1 'potassium chloride-3' 100 ? mM ? 1 DTT-4 1 ? mM ? 1 protein-5 1.2 ? mM '[U-95% 13C; U-95% 15N]' 2 'potassium phosphate-6' 20 ? mM ? 2 'potassium chloride-7' 100 ? mM ? 2 DTT-8 1 ? mM ? 2 protein-9 1.1 ? mM ? 3 'potassium phosphate-10' 20 ? mM ? 3 'potassium chloride-11' 100 ? mM ? 3 DTT-12 1 ? mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 3 '2D 1H-1H NOESY' 1 4 3 '2D 1H-1H TOCSY' 1 5 2 '3D CBCA(CO)NH' 1 6 2 '3D HNCACB' 1 7 2 '3D HNCO' 1 8 1 '3D HNHA' 1 9 2 '3D HCCH-TOCSY' 1 10 1 '3D 1H-15N NOESY' 1 11 2 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2L2Q _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 2 'Koradi, Billeter and Wuthrich' 'structure display' MOLMOL ? 3 'Bruker Biospin' collection TopSpin ? 4 CCPN 'chemical shift assignment' CcpNMR ? 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 6 'Duggan, Legge, Dyson & Wright' 'data analysis' SANE ? 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TYR N N N N 297 TYR CA C N S 298 TYR C C N N 299 TYR O O N N 300 TYR CB C N N 301 TYR CG C Y N 302 TYR CD1 C Y N 303 TYR CD2 C Y N 304 TYR CE1 C Y N 305 TYR CE2 C Y N 306 TYR CZ C Y N 307 TYR OH O N N 308 TYR OXT O N N 309 TYR H H N N 310 TYR H2 H N N 311 TYR HA H N N 312 TYR HB2 H N N 313 TYR HB3 H N N 314 TYR HD1 H N N 315 TYR HD2 H N N 316 TYR HE1 H N N 317 TYR HE2 H N N 318 TYR HH H N N 319 TYR HXT H N N 320 VAL N N N N 321 VAL CA C N S 322 VAL C C N N 323 VAL O O N N 324 VAL CB C N N 325 VAL CG1 C N N 326 VAL CG2 C N N 327 VAL OXT O N N 328 VAL H H N N 329 VAL H2 H N N 330 VAL HA H N N 331 VAL HB H N N 332 VAL HG11 H N N 333 VAL HG12 H N N 334 VAL HG13 H N N 335 VAL HG21 H N N 336 VAL HG22 H N N 337 VAL HG23 H N N 338 VAL HXT H N N 339 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AMX 1 'Bruker AMX' 600 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2L2Q _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_