data_2LC3 # _entry.id 2LC3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LC3 pdb_00002lc3 10.2210/pdb2lc3/pdb RCSB RCSB102213 ? ? BMRB 17594 ? ? WWPDB D_1000102213 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17594 BMRB unspecified . HT6305A TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LC3 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-04-15 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lemak, A.' 1 'Yee, A.' 2 'Houliston, S.' 3 'Garcia, M.' 4 'Arrowsmith, C.' 5 'Dhe-Paganon, S.' 6 'Montelione, G.T.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 'Structural Genomics Consortium (SGC)' 9 # _citation.id primary _citation.title 'NMR solution structure of a helical bundle from the E3 ligase HECTD1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lemak, A.' 1 ? primary 'Yee, A.' 2 ? primary 'Houliston, S.' 3 ? primary 'Garcia, M.' 4 ? primary 'Arrowsmith, C.' 5 ? primary 'Dhe-Paganon, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'E3 ubiquitin-protein ligase HECTD1' _entity.formula_weight 10079.366 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 6.3.2.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 1879-1966' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'E3 ligase for inhibin receptor, EULIR, HECT domain-containing protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKDSDKEKENGKMGCWSIEHVEQYLGTDELPKNDLITYLQKNADAAFLRHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHG TKSGLNQG ; _entity_poly.pdbx_seq_one_letter_code_can ;MKDSDKEKENGKMGCWSIEHVEQYLGTDELPKNDLITYLQKNADAAFLRHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHG TKSGLNQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HT6305A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ASP n 1 4 SER n 1 5 ASP n 1 6 LYS n 1 7 GLU n 1 8 LYS n 1 9 GLU n 1 10 ASN n 1 11 GLY n 1 12 LYS n 1 13 MET n 1 14 GLY n 1 15 CYS n 1 16 TRP n 1 17 SER n 1 18 ILE n 1 19 GLU n 1 20 HIS n 1 21 VAL n 1 22 GLU n 1 23 GLN n 1 24 TYR n 1 25 LEU n 1 26 GLY n 1 27 THR n 1 28 ASP n 1 29 GLU n 1 30 LEU n 1 31 PRO n 1 32 LYS n 1 33 ASN n 1 34 ASP n 1 35 LEU n 1 36 ILE n 1 37 THR n 1 38 TYR n 1 39 LEU n 1 40 GLN n 1 41 LYS n 1 42 ASN n 1 43 ALA n 1 44 ASP n 1 45 ALA n 1 46 ALA n 1 47 PHE n 1 48 LEU n 1 49 ARG n 1 50 HIS n 1 51 TRP n 1 52 LYS n 1 53 LEU n 1 54 THR n 1 55 GLY n 1 56 THR n 1 57 ASN n 1 58 LYS n 1 59 SER n 1 60 ILE n 1 61 ARG n 1 62 LYS n 1 63 ASN n 1 64 ARG n 1 65 ASN n 1 66 CYS n 1 67 SER n 1 68 GLN n 1 69 LEU n 1 70 ILE n 1 71 ALA n 1 72 ALA n 1 73 TYR n 1 74 LYS n 1 75 ASP n 1 76 PHE n 1 77 CYS n 1 78 GLU n 1 79 HIS n 1 80 GLY n 1 81 THR n 1 82 LYS n 1 83 SER n 1 84 GLY n 1 85 LEU n 1 86 ASN n 1 87 GLN n 1 88 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HECTD1, KIAA1131' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28-MHL _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HECD1_HUMAN _struct_ref.pdbx_db_accession Q9ULT8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKDSDKEKENGKMGCWSIEHVEQYLGTDELPKNDLITYLQKNADAAFLRHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHG TKSGLNQG ; _struct_ref.pdbx_align_begin 1879 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LC3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ULT8 _struct_ref_seq.db_align_beg 1879 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1966 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 88 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY aliphatic' 1 9 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 500 _pdbx_nmr_exptl_sample_conditions.pH 7.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.5 mM [U-13C; U-15N] protein, 10 mM TRIS, 500 mM sodium chloride, 10 uM ZnSO4, 10 mM DTT, 0.01 % NaN3, 10 mM benzamidine, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LC3 _pdbx_nmr_refine.method 'restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LC3 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LC3 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'peak picking' Sparky ? 2 'Lemak,Steren,Llinas, Arrowsmith' 'chemical shift assignment' FMC ? 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 4 'Bhattacharya and Montelione' validation PSVS ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LC3 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LC3 _struct.title ;Solution NMR structure of a helical bundle domain from human E3 ligase HECTD1. Northeast structural genomics consortium (NESG) target HT6305A ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LC3 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;helical bundle, Structural Genomics, Northeast Structural Genomics Consortium, NESG, STRUCTURAL GENOMICS CONSORTIUM, SGC, LIGASE, PSI-Biology ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? GLU A 9 ? SER A 4 GLU A 9 1 ? 6 HELX_P HELX_P2 2 SER A 17 ? LEU A 25 ? SER A 17 LEU A 25 1 ? 9 HELX_P HELX_P3 3 PRO A 31 ? ALA A 43 ? PRO A 31 ALA A 43 1 ? 13 HELX_P HELX_P4 4 ASP A 44 ? TRP A 51 ? ASP A 44 TRP A 51 1 ? 8 HELX_P HELX_P5 5 THR A 56 ? ARG A 64 ? THR A 56 ARG A 64 1 ? 9 HELX_P HELX_P6 6 ASN A 65 ? GLY A 80 ? ASN A 65 GLY A 80 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LC3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 GLY 88 88 88 GLY GLY A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-06-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 0.5 ? mM '[U-13C; U-15N]' 1 TRIS-2 10 ? mM ? 1 'sodium chloride-3' 500 ? mM ? 1 ZnSO4-4 10 ? uM ? 1 DTT-5 10 ? mM ? 1 NaN3-6 0.01 ? % ? 1 benzamidine-7 10 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 LYS A 8 ? ? -102.09 43.37 2 2 LYS A 12 ? ? -65.13 86.12 3 2 ASN A 86 ? ? -112.87 68.98 4 3 LYS A 12 ? ? -67.50 86.99 5 3 LEU A 85 ? ? -64.71 89.33 6 4 LYS A 12 ? ? -65.49 87.31 7 4 ASN A 65 ? ? -125.17 -146.13 8 4 LEU A 85 ? ? -94.86 44.06 9 4 ASN A 86 ? ? -88.14 46.02 10 6 THR A 81 ? ? -39.55 121.95 11 7 LEU A 85 ? ? -67.54 -70.17 12 9 GLU A 7 ? ? -132.05 -46.61 13 9 THR A 81 ? ? -43.83 150.83 14 11 LYS A 8 ? ? -96.68 45.17 15 11 LEU A 30 ? ? -150.36 85.76 16 12 THR A 81 ? ? -44.26 150.75 17 13 ASP A 5 ? ? -66.91 0.95 18 13 SER A 83 ? ? 52.12 13.96 19 14 LYS A 12 ? ? -64.54 95.07 20 15 SER A 83 ? ? -44.65 -19.14 21 15 LEU A 85 ? ? -126.74 -62.13 22 16 LEU A 30 ? ? -151.41 83.71 23 17 LYS A 8 ? ? -118.24 73.18 24 17 LEU A 30 ? ? -151.32 85.99 25 17 THR A 81 ? ? -42.83 155.57 26 17 ASN A 86 ? ? -144.60 13.13 27 18 THR A 81 ? ? -37.97 123.76 28 19 THR A 81 ? ? -44.67 153.15 29 20 LYS A 8 ? ? -150.22 9.68 30 20 SER A 83 ? ? -83.24 30.96 #