data_2LM4 # _entry.id 2LM4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LM4 pdb_00002lm4 10.2210/pdb2lm4/pdb RCSB RCSB102550 ? ? BMRB 18098 ? ? WWPDB D_1000102550 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified YT682A TargetDB . unspecified 18098 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LM4 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-11-22 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eletsky, A.' 1 'Winge, D.R.' 2 'Lee, H.' 3 'Lee, D.' 4 'Kohan, E.' 5 'Hamilton, K.' 6 'Acton, T.B.' 7 'Xiao, R.' 8 'Everett, J.K.' 9 'Prestegard, J.H.' 10 'Montelione, G.T.' 11 'Szyperski, T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 'Mitochondrial Protein Partnership (MPP)' 14 # _citation.id primary _citation.title 'Solution NMR structure of yeast succinate dehydrogenase flavinylation factor sdh5 reveals a putative sdh1 binding site.' _citation.journal_abbrev Biochemistry _citation.journal_volume 51 _citation.page_first 8475 _citation.page_last 8477 _citation.year 2012 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23062074 _citation.pdbx_database_id_DOI 10.1021/bi301171u # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eletsky, A.' 1 ? primary 'Jeong, M.Y.' 2 ? primary 'Kim, H.' 3 ? primary 'Lee, H.W.' 4 ? primary 'Xiao, R.' 5 ? primary 'Pagliarini, D.J.' 6 ? primary 'Prestegard, J.H.' 7 ? primary 'Winge, D.R.' 8 ? primary 'Montelione, G.T.' 9 ? primary 'Szyperski, T.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Succinate dehydrogenase assembly factor 2, mitochondrial' _entity.formula_weight 13193.031 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 55-152' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SDH assembly factor 2, Early meiotic induction protein 5, Succinate dehydrogenase subunit 5, mitochondrial' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNF KTSPLPDKWANSKLLKQLQEFSENKEKEI ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNF KTSPLPDKWANSKLLKQLQEFSENKEKEI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier YT682A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 ILE n 1 13 LYS n 1 14 ARG n 1 15 THR n 1 16 ASN n 1 17 GLU n 1 18 PRO n 1 19 LEU n 1 20 ASP n 1 21 LYS n 1 22 LYS n 1 23 ARG n 1 24 ALA n 1 25 ARG n 1 26 LEU n 1 27 ILE n 1 28 TYR n 1 29 GLN n 1 30 SER n 1 31 ARG n 1 32 LYS n 1 33 ARG n 1 34 GLY n 1 35 ILE n 1 36 LEU n 1 37 GLU n 1 38 THR n 1 39 ASP n 1 40 LEU n 1 41 LEU n 1 42 LEU n 1 43 SER n 1 44 GLY n 1 45 PHE n 1 46 ALA n 1 47 ALA n 1 48 LYS n 1 49 TYR n 1 50 LEU n 1 51 LYS n 1 52 LYS n 1 53 MET n 1 54 ASN n 1 55 GLU n 1 56 GLU n 1 57 GLU n 1 58 LEU n 1 59 GLU n 1 60 GLU n 1 61 TYR n 1 62 ASP n 1 63 SER n 1 64 LEU n 1 65 LEU n 1 66 ASN n 1 67 GLU n 1 68 LEU n 1 69 ASP n 1 70 TRP n 1 71 ASP n 1 72 ILE n 1 73 TYR n 1 74 TYR n 1 75 TRP n 1 76 ALA n 1 77 THR n 1 78 LYS n 1 79 ASN n 1 80 PHE n 1 81 LYS n 1 82 THR n 1 83 SER n 1 84 PRO n 1 85 LEU n 1 86 PRO n 1 87 ASP n 1 88 LYS n 1 89 TRP n 1 90 ALA n 1 91 ASN n 1 92 SER n 1 93 LYS n 1 94 LEU n 1 95 LEU n 1 96 LYS n 1 97 GLN n 1 98 LEU n 1 99 GLN n 1 100 GLU n 1 101 PHE n 1 102 SER n 1 103 GLU n 1 104 ASN n 1 105 LYS n 1 106 GLU n 1 107 LYS n 1 108 GLU n 1 109 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EMI5, SDH5, YOL071W' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SDHF2_YEAST _struct_ref.pdbx_db_accession Q08230 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWAN SKLLKQLQEFSENKEKEI ; _struct_ref.pdbx_align_begin 55 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LM4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q08230 _struct_ref_seq.db_align_beg 55 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 152 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LM4 MET A 1 ? UNP Q08230 ? ? 'expression tag' 1 1 1 2LM4 GLY A 2 ? UNP Q08230 ? ? 'expression tag' 2 2 1 2LM4 HIS A 3 ? UNP Q08230 ? ? 'expression tag' 3 3 1 2LM4 HIS A 4 ? UNP Q08230 ? ? 'expression tag' 4 4 1 2LM4 HIS A 5 ? UNP Q08230 ? ? 'expression tag' 5 5 1 2LM4 HIS A 6 ? UNP Q08230 ? ? 'expression tag' 6 6 1 2LM4 HIS A 7 ? UNP Q08230 ? ? 'expression tag' 7 7 1 2LM4 HIS A 8 ? UNP Q08230 ? ? 'expression tag' 8 8 1 2LM4 SER A 9 ? UNP Q08230 ? ? 'expression tag' 9 9 1 2LM4 HIS A 10 ? UNP Q08230 ? ? 'expression tag' 10 10 1 2LM4 MET A 11 ? UNP Q08230 ? ? 'expression tag' 11 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C CT-HSQC aliphatic' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 1 '3D HN(CA)CO' 1 9 1 '2D 1H-13C CT-HSQC aromatic' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D (H)CCH-COSY aliphatic' 1 12 1 '3D (H)CCH-COSY aromatic' 1 13 1 '1D 15N T1' 1 14 1 '1D 15N T2' 1 15 2 '2D 1H-13C CT-HSQC methyl' 1 16 2 '2D J-resolved 1H-15N HSQC' 1 17 3 '2D J-resolved 1H-15N HSQC' 1 18 4 '2D J-resolved 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.0 mM [U-100% 13C; U-100% 15N] YT682A, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 50 uM DSS, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;1.1 mM [5% 13C; U-100% 15N] YT682A, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 50 uM DSS, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' ;0.7 mM [5% 13C; U-100% 15N] YT682A, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 50 uM DSS, 4 % C12E5 PEG, 4 % hexanol, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' ;1.1 mM [5% 13C; U-100% 15N] YT682A, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 50 uM DSS, 90% H2O/10% D2O ; 4 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LM4 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Structure determination was performed by running CYANA and ASDP in parallel using NOE-based constraints and PHI and PSI dihedral angle constraints from TALOS+. Consensus peak assignments were selected and used in iterative refinement with CYANA, with RDC constraints added at later stages. The 20 conformers out of 100 with the lowest target function were further refined by simulated annealing in explicit water bath using the program CNS with PARAM19 force field ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LM4 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LM4 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'refinement, structure solution, geometry optimization' CNS 1.2 1 'Guntert, Mumenthaler and Wuthrich' 'refinement, geometry optimization, structure solution' CYANA 3.0 2 'Huang, Tejero, Powers and Montelione' 'data analysis, refinement' ASDP 1.0 3 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis, chemical shift assignment' AutoAssign 2.3.0 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Bartels et al.' 'data analysis' XEASY 1.3.13 6 Guntert processing PROSA 6.4 7 Varian collection VnmrJ 2.2D 8 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 9 'Keller and Wuthrich' 'data analysis,peak picking,chemical shift assignment' CARA 1.8.4 10 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 11 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LM4 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LM4 _struct.title ;Solution NMR Structure of mitochondrial succinate dehydrogenase assembly factor 2 from Saccharomyces cerevisiae, Northeast Structural Genomics Consortium Target YT682A ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LM4 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, PROTEIN BINDING, Mitochondrial Protein Partnership, MPP ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 18 ? ARG A 31 ? PRO A 18 ARG A 31 1 ? 14 HELX_P HELX_P2 2 ILE A 35 ? MET A 53 ? ILE A 35 MET A 53 1 ? 19 HELX_P HELX_P3 3 ASN A 54 ? ASN A 66 ? ASN A 54 ASN A 66 1 ? 13 HELX_P HELX_P4 4 LEU A 68 ? THR A 77 ? LEU A 68 THR A 77 1 ? 10 HELX_P HELX_P5 5 PRO A 86 ? ASN A 91 ? PRO A 86 ASN A 91 1 ? 6 HELX_P HELX_P6 6 SER A 92 ? LYS A 105 ? SER A 92 LYS A 105 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2LM4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ILE 109 109 109 ILE ILE A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG PSI:Biology 'Mitochondrial Protein Partnership' 2 MPP PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-01-04 2 'Structure model' 1 1 2012-12-05 3 'Structure model' 1 2 2013-01-30 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id YT682A-1 1.0 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 DTT-5 10 ? mM ? 1 'sodium azide-6' 0.02 ? % ? 1 DSS-7 50 ? uM ? 1 YT682A-8 1.1 ? mM '[5% 13C; U-100% 15N]' 2 MES-9 20 ? mM ? 2 'sodium chloride-10' 100 ? mM ? 2 'calcium chloride-11' 5 ? mM ? 2 DTT-12 10 ? mM ? 2 'sodium azide-13' 0.02 ? % ? 2 DSS-14 50 ? uM ? 2 YT682A-15 0.7 ? mM '[5% 13C; U-100% 15N]' 3 MES-16 20 ? mM ? 3 'sodium chloride-17' 100 ? mM ? 3 'calcium chloride-18' 5 ? mM ? 3 DTT-19 10 ? mM ? 3 'sodium azide-20' 0.02 ? % ? 3 DSS-21 50 ? uM ? 3 'C12E5 PEG-22' 4 ? % ? 3 hexanol-23 4 ? % ? 3 YT682A-24 1.1 ? mM '[5% 13C; U-100% 15N]' 4 MES-25 20 ? mM ? 4 'sodium chloride-26' 100 ? mM ? 4 'calcium chloride-27' 5 ? mM ? 4 DTT-28 10 ? mM ? 4 'sodium azide-29' 0.02 ? % ? 4 DSS-30 50 ? uM ? 4 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LM4 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1723 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 525 _pdbx_nmr_constraints.NOE_long_range_total_count 390 _pdbx_nmr_constraints.NOE_medium_range_total_count 406 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 402 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 59 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 104 ? ? -90.02 -77.27 2 1 LYS A 105 ? ? 45.65 -80.85 3 2 HIS A 4 ? ? -154.71 79.52 4 2 ASN A 16 ? ? 59.91 -162.15 5 2 LYS A 78 ? ? -67.42 84.69 6 2 THR A 82 ? ? -162.83 -32.34 7 3 SER A 9 ? ? 62.17 179.75 8 3 LYS A 107 ? ? 43.40 84.67 9 4 HIS A 5 ? ? 54.79 80.50 10 4 SER A 9 ? ? -136.39 -68.70 11 4 LYS A 13 ? ? 64.01 95.48 12 4 THR A 15 ? ? -151.71 -79.02 13 4 ASN A 16 ? ? -138.93 -65.89 14 5 GLU A 17 ? ? 55.84 79.45 15 5 LYS A 105 ? ? -68.84 87.95 16 6 LYS A 78 ? ? 55.07 70.91 17 7 HIS A 3 ? ? -79.47 -81.86 18 7 HIS A 6 ? ? -131.94 -78.43 19 7 HIS A 7 ? ? -141.77 -79.56 20 7 HIS A 8 ? ? 58.54 -163.54 21 7 SER A 9 ? ? 67.85 -173.56 22 7 MET A 11 ? ? 63.05 178.48 23 7 PHE A 80 ? ? 65.28 -79.13 24 7 LYS A 81 ? ? 51.41 -74.82 25 8 HIS A 4 ? ? -144.92 -7.35 26 8 SER A 9 ? ? 59.95 -166.19 27 8 ARG A 14 ? ? 56.27 82.79 28 8 GLU A 106 ? ? -146.04 -74.80 29 9 HIS A 8 ? ? -162.24 11.69 30 9 ILE A 12 ? ? -100.82 75.79 31 9 ASN A 16 ? ? 72.60 164.29 32 9 LYS A 107 ? ? 60.48 103.77 33 10 SER A 9 ? ? -68.67 -87.93 34 10 LYS A 13 ? ? -69.67 99.95 35 10 GLU A 17 ? ? 63.35 91.68 36 10 ASN A 79 ? ? -94.43 48.59 37 11 HIS A 5 ? ? -62.98 96.85 38 11 HIS A 7 ? ? -132.92 -37.39 39 11 MET A 11 ? ? -55.80 104.73 40 11 ILE A 12 ? ? 63.22 128.92 41 11 ASN A 79 ? ? -65.51 -72.75 42 12 HIS A 7 ? ? -133.06 -55.75 43 12 LYS A 78 ? ? -96.14 39.68 44 12 ASN A 79 ? ? -110.68 51.22 45 12 GLU A 106 ? ? -127.41 -81.11 46 12 LYS A 107 ? ? -162.92 36.66 47 13 HIS A 5 ? ? -151.03 50.41 48 13 HIS A 10 ? ? 65.13 95.93 49 13 ILE A 12 ? ? -67.01 95.55 50 13 ASN A 79 ? ? -67.37 -71.73 51 13 PHE A 80 ? ? 67.14 -12.96 52 13 LYS A 105 ? ? -69.65 87.68 53 13 LYS A 107 ? ? 59.18 19.57 54 14 HIS A 10 ? ? -160.94 20.42 55 14 ARG A 33 ? ? -149.65 -157.84 56 14 ASN A 79 ? ? -90.43 41.16 57 14 LYS A 105 ? ? -69.02 81.56 58 15 HIS A 5 ? ? 62.52 -168.08 59 15 HIS A 8 ? ? -147.16 -33.16 60 15 SER A 9 ? ? 55.82 -158.22 61 15 LYS A 13 ? ? 65.04 113.32 62 15 THR A 15 ? ? -135.60 -65.46 63 16 HIS A 10 ? ? -84.80 49.29 64 16 LYS A 13 ? ? -67.40 88.88 65 16 GLU A 17 ? ? 58.19 72.15 66 16 THR A 82 ? ? -131.45 -30.02 67 16 LYS A 105 ? ? -87.13 31.49 68 17 GLU A 17 ? ? -152.26 77.72 69 17 LYS A 105 ? ? -80.87 41.90 70 18 HIS A 8 ? ? -79.92 47.53 71 19 HIS A 6 ? ? 57.87 85.58 72 19 HIS A 10 ? ? -83.69 31.97 73 19 ILE A 12 ? ? -69.21 87.92 74 19 ASN A 16 ? ? -95.38 -78.33 75 19 GLU A 17 ? ? 51.23 83.76 76 19 ASN A 79 ? ? -127.12 -74.45 77 19 PHE A 80 ? ? 66.58 -4.11 78 20 SER A 9 ? ? 59.12 -164.86 79 20 HIS A 10 ? ? 72.48 -9.16 80 20 ILE A 12 ? ? 45.49 92.42 81 20 ASN A 16 ? ? 65.48 76.84 82 20 GLU A 17 ? ? 61.33 98.69 83 20 ALA A 90 ? ? -58.82 102.85 #