data_2LRC # _entry.id 2LRC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LRC pdb_00002lrc 10.2210/pdb2lrc/pdb RCSB RCSB102736 ? ? BMRB 18130 ? 10.13018/BMR18130 WWPDB D_1000102736 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-04-17 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LRC _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-03-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 18130 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Garcin, E.B.' 1 'Kreuzer, C.' 2 'Bornet, O.' 3 'Guerlesquin, F.' 4 # _citation.id primary _citation.title 'An unusual thioredoxin from Pseudomonas aeruginosa' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Garcin, E.B.' 1 ? primary 'Bornet, O.' 2 ? primary 'Nouailler, M.' 3 ? primary 'Guerlesquin, F.' 4 ? primary 'Sebban-Kreuzer, C.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Probable thioredoxin' _entity.formula_weight 12777.333 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPEVGHLKVEDGPGRRLGRSFQVKLWPTFVFLR DGREVARVVRPGSASVLEEAFESLVGEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPEVGHLKVEDGPGRRLGRSFQVKLWPTFVFLR DGREVARVVRPGSASVLEEAFESLVGEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 ARG n 1 5 TYR n 1 6 SER n 1 7 ALA n 1 8 GLU n 1 9 ALA n 1 10 PRO n 1 11 ALA n 1 12 ARG n 1 13 ASP n 1 14 GLU n 1 15 LEU n 1 16 ASP n 1 17 ARG n 1 18 LEU n 1 19 ALA n 1 20 GLY n 1 21 PRO n 1 22 THR n 1 23 LEU n 1 24 VAL n 1 25 GLU n 1 26 PHE n 1 27 GLY n 1 28 THR n 1 29 ASP n 1 30 TRP n 1 31 CYS n 1 32 GLY n 1 33 HIS n 1 34 CYS n 1 35 GLN n 1 36 ALA n 1 37 ALA n 1 38 GLN n 1 39 PRO n 1 40 LEU n 1 41 LEU n 1 42 ALA n 1 43 GLU n 1 44 VAL n 1 45 PHE n 1 46 SER n 1 47 ASP n 1 48 TYR n 1 49 PRO n 1 50 GLU n 1 51 VAL n 1 52 GLY n 1 53 HIS n 1 54 LEU n 1 55 LYS n 1 56 VAL n 1 57 GLU n 1 58 ASP n 1 59 GLY n 1 60 PRO n 1 61 GLY n 1 62 ARG n 1 63 ARG n 1 64 LEU n 1 65 GLY n 1 66 ARG n 1 67 SER n 1 68 PHE n 1 69 GLN n 1 70 VAL n 1 71 LYS n 1 72 LEU n 1 73 TRP n 1 74 PRO n 1 75 THR n 1 76 PHE n 1 77 VAL n 1 78 PHE n 1 79 LEU n 1 80 ARG n 1 81 ASP n 1 82 GLY n 1 83 ARG n 1 84 GLU n 1 85 VAL n 1 86 ALA n 1 87 ARG n 1 88 VAL n 1 89 VAL n 1 90 ARG n 1 91 PRO n 1 92 GLY n 1 93 SER n 1 94 ALA n 1 95 SER n 1 96 VAL n 1 97 LEU n 1 98 GLU n 1 99 GLU n 1 100 ALA n 1 101 PHE n 1 102 GLU n 1 103 SER n 1 104 LEU n 1 105 VAL n 1 106 GLY n 1 107 GLU n 1 108 GLY n 1 109 HIS n 1 110 HIS n 1 111 HIS n 1 112 HIS n 1 113 HIS n 1 114 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PA2694 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain PAO1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pJF119EH _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 HIS 109 109 ? ? ? A . n A 1 110 HIS 110 110 ? ? ? A . n A 1 111 HIS 111 111 ? ? ? A . n A 1 112 HIS 112 112 ? ? ? A . n A 1 113 HIS 113 113 ? ? ? A . n A 1 114 HIS 114 114 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LRC _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LRC _struct.title 'Structure of thioredoxin 2 from Pseudomonas aeruginosa PAO1 in its reduced form' _struct.pdbx_model_details 'closest to the average, model 14' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LRC _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'thioredoxin fold, oxidoreductase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9I0E8_PSEAE _struct_ref.pdbx_db_accession Q9I0E8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPEVGHLKVEDGPGRRLGRSFQVKLWPTFVFLR DGREVARVVRPGSASVLEEAFESLVGEG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LRC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9I0E8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LRC HIS A 109 ? UNP Q9I0E8 ? ? 'expression tag' 109 1 1 2LRC HIS A 110 ? UNP Q9I0E8 ? ? 'expression tag' 110 2 1 2LRC HIS A 111 ? UNP Q9I0E8 ? ? 'expression tag' 111 3 1 2LRC HIS A 112 ? UNP Q9I0E8 ? ? 'expression tag' 112 4 1 2LRC HIS A 113 ? UNP Q9I0E8 ? ? 'expression tag' 113 5 1 2LRC HIS A 114 ? UNP Q9I0E8 ? ? 'expression tag' 114 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 11 ? ASP A 16 ? ALA A 11 ASP A 16 1 ? 6 HELX_P HELX_P2 2 CYS A 31 ? SER A 46 ? CYS A 31 SER A 46 1 ? 16 HELX_P HELX_P3 3 ARG A 63 ? PHE A 68 ? ARG A 63 PHE A 68 1 ? 6 HELX_P HELX_P4 4 SER A 93 ? GLY A 106 ? SER A 93 GLY A 106 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 52 ? GLU A 57 ? GLY A 52 GLU A 57 A 2 THR A 22 ? GLY A 27 ? THR A 22 GLY A 27 A 3 THR A 75 ? ARG A 80 ? THR A 75 ARG A 80 A 4 ARG A 83 ? VAL A 89 ? ARG A 83 VAL A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 56 ? O VAL A 56 N GLU A 25 ? N GLU A 25 A 2 3 N PHE A 26 ? N PHE A 26 O THR A 75 ? O THR A 75 A 3 4 N PHE A 78 ? N PHE A 78 O VAL A 85 ? O VAL A 85 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.41 120.30 3.11 0.50 N 2 2 NE A ARG 62 ? ? CZ A ARG 62 ? ? NH1 A ARG 62 ? ? 123.37 120.30 3.07 0.50 N 3 3 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 123.62 120.30 3.32 0.50 N 4 8 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 123.32 120.30 3.02 0.50 N 5 9 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.36 120.30 3.06 0.50 N 6 12 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 123.66 120.30 3.36 0.50 N 7 12 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.33 120.30 3.03 0.50 N 8 13 NE A ARG 62 ? ? CZ A ARG 62 ? ? NH1 A ARG 62 ? ? 123.35 120.30 3.05 0.50 N 9 14 NE A ARG 62 ? ? CZ A ARG 62 ? ? NH1 A ARG 62 ? ? 123.30 120.30 3.00 0.50 N 10 16 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 123.35 120.30 3.05 0.50 N 11 18 NE A ARG 17 ? ? CZ A ARG 17 ? ? NH1 A ARG 17 ? ? 123.30 120.30 3.00 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 8 ? ? -78.44 23.03 2 1 ARG A 90 ? ? 54.62 81.77 3 2 ARG A 62 ? ? 72.65 152.60 4 2 ARG A 63 ? ? -98.94 -112.19 5 2 LEU A 72 ? ? -96.78 -130.72 6 2 TRP A 73 ? ? -138.57 -48.02 7 2 ALA A 86 ? ? -171.22 -179.06 8 2 ARG A 90 ? ? 56.53 77.02 9 3 GLU A 8 ? ? -79.98 41.98 10 3 ARG A 62 ? ? 52.18 -132.47 11 3 ARG A 63 ? ? 75.71 155.89 12 3 LEU A 72 ? ? -101.60 -109.94 13 3 TRP A 73 ? ? -147.23 -49.93 14 3 ARG A 90 ? ? 56.05 79.42 15 4 LYS A 2 ? ? 49.93 -133.47 16 4 ALA A 19 ? ? -134.61 -39.42 17 4 ASP A 58 ? ? -91.99 -150.41 18 4 LEU A 64 ? ? 71.97 -44.15 19 4 LEU A 72 ? ? -112.60 -118.63 20 4 TRP A 73 ? ? -151.58 -50.10 21 4 ALA A 86 ? ? -171.63 -179.40 22 5 GLU A 8 ? ? -76.77 36.44 23 5 ALA A 19 ? ? -136.53 -41.44 24 5 ARG A 62 ? ? 77.18 122.43 25 5 ARG A 63 ? ? -93.36 -131.70 26 5 LEU A 72 ? ? -118.20 -116.76 27 5 TRP A 73 ? ? -147.89 -49.92 28 5 ARG A 90 ? ? 52.73 77.58 29 6 GLU A 8 ? ? -85.19 37.16 30 6 LEU A 64 ? ? 102.68 -55.69 31 6 LEU A 72 ? ? -97.58 -119.62 32 6 TRP A 73 ? ? -139.18 -50.15 33 6 ARG A 90 ? ? 57.84 76.44 34 7 GLU A 8 ? ? -76.11 37.34 35 7 ALA A 19 ? ? -148.29 -48.79 36 7 LEU A 72 ? ? -103.88 -117.15 37 7 TRP A 73 ? ? -142.41 -51.23 38 7 ARG A 90 ? ? 56.74 81.33 39 8 GLU A 8 ? ? -74.70 31.05 40 8 ALA A 19 ? ? -133.67 -36.18 41 8 ARG A 62 ? ? 72.76 125.13 42 8 ARG A 63 ? ? -94.14 -111.07 43 8 LEU A 72 ? ? -91.52 -129.46 44 8 TRP A 73 ? ? -150.03 -49.20 45 8 ARG A 90 ? ? 50.80 78.35 46 9 GLU A 8 ? ? -88.65 40.90 47 9 ALA A 19 ? ? -142.82 -45.32 48 9 ARG A 63 ? ? 69.47 159.28 49 9 LEU A 64 ? ? -151.15 -28.11 50 9 LYS A 71 ? ? -80.38 -96.19 51 9 ARG A 90 ? ? 55.91 81.60 52 10 GLU A 8 ? ? -79.46 39.47 53 10 ALA A 19 ? ? -138.26 -34.64 54 11 GLU A 8 ? ? -86.37 38.79 55 11 ASP A 58 ? ? -102.48 -125.00 56 11 LEU A 64 ? ? 67.12 -45.21 57 11 LEU A 72 ? ? -96.51 -123.22 58 11 TRP A 73 ? ? -141.95 -49.48 59 11 ARG A 90 ? ? 56.12 70.45 60 12 GLU A 8 ? ? -80.09 42.39 61 12 ALA A 19 ? ? -146.90 -45.95 62 12 ARG A 63 ? ? -90.83 -120.10 63 12 LEU A 72 ? ? -101.86 -112.34 64 12 TRP A 73 ? ? -151.11 -46.59 65 13 ARG A 90 ? ? 53.40 85.32 66 14 ALA A 19 ? ? -136.04 -45.25 67 14 ARG A 90 ? ? 55.44 77.39 68 15 ARG A 4 ? ? -91.49 -159.62 69 15 ALA A 19 ? ? -139.41 -35.72 70 15 LEU A 64 ? ? -137.42 -38.53 71 15 LYS A 71 ? ? -70.09 -97.06 72 15 ARG A 90 ? ? 55.02 80.58 73 16 GLU A 8 ? ? -78.23 30.63 74 16 ARG A 63 ? ? 77.71 133.06 75 16 LEU A 64 ? ? -135.13 -30.02 76 16 LEU A 72 ? ? -97.36 -117.22 77 16 TRP A 73 ? ? -156.73 -50.70 78 17 GLU A 8 ? ? -73.78 22.99 79 17 ALA A 19 ? ? -153.87 70.09 80 17 LYS A 71 ? ? -74.46 -102.95 81 17 ARG A 90 ? ? 40.81 80.67 82 18 ASP A 58 ? ? -105.23 -163.10 83 18 ARG A 63 ? ? -119.56 -122.25 84 18 LEU A 72 ? ? -92.83 -124.79 85 18 TRP A 73 ? ? -150.23 -49.51 86 18 ALA A 86 ? ? -173.21 -179.73 87 19 GLU A 8 ? ? -90.87 40.13 88 19 ALA A 19 ? ? -135.14 -45.57 89 19 LYS A 71 ? ? -83.54 -97.59 90 20 GLU A 8 ? ? -76.81 32.78 91 20 ALA A 19 ? ? -138.09 -34.23 92 20 ARG A 63 ? ? -79.80 -85.46 93 20 LYS A 71 ? ? -81.17 -86.51 94 20 ARG A 90 ? ? 55.12 80.00 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 9 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 17 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.076 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LRC _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LRC _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '0.8 mM [U-99% 13C; U-99% 15N] potassium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component 'potassium phosphate-1' _pdbx_nmr_exptl_sample.concentration 0.8 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '2D CBCACO' 1 10 1 '3D HN(CA)CO' 1 11 1 '3D HBHANH' 1 12 1 '2D (HB)CB(CGCD)HD' 1 13 1 '2D (HB)CB(CGCDCE)HE' 1 14 1 '3D HSQC-NOESY 13C' 1 15 1 '3D HSQC-NOESY 15N' # _pdbx_nmr_refine.entry_id 2LRC _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 1 'Keller and Wuthrich' 'peak picking' CARA ? 2 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollman' refinement Amber ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 109 ? A HIS 109 2 1 Y 1 A HIS 110 ? A HIS 110 3 1 Y 1 A HIS 111 ? A HIS 111 4 1 Y 1 A HIS 112 ? A HIS 112 5 1 Y 1 A HIS 113 ? A HIS 113 6 1 Y 1 A HIS 114 ? A HIS 114 7 2 Y 1 A HIS 109 ? A HIS 109 8 2 Y 1 A HIS 110 ? A HIS 110 9 2 Y 1 A HIS 111 ? A HIS 111 10 2 Y 1 A HIS 112 ? A HIS 112 11 2 Y 1 A HIS 113 ? A HIS 113 12 2 Y 1 A HIS 114 ? A HIS 114 13 3 Y 1 A HIS 109 ? A HIS 109 14 3 Y 1 A HIS 110 ? A HIS 110 15 3 Y 1 A HIS 111 ? A HIS 111 16 3 Y 1 A HIS 112 ? A HIS 112 17 3 Y 1 A HIS 113 ? A HIS 113 18 3 Y 1 A HIS 114 ? A HIS 114 19 4 Y 1 A HIS 109 ? A HIS 109 20 4 Y 1 A HIS 110 ? A HIS 110 21 4 Y 1 A HIS 111 ? A HIS 111 22 4 Y 1 A HIS 112 ? A HIS 112 23 4 Y 1 A HIS 113 ? A HIS 113 24 4 Y 1 A HIS 114 ? A HIS 114 25 5 Y 1 A HIS 109 ? A HIS 109 26 5 Y 1 A HIS 110 ? A HIS 110 27 5 Y 1 A HIS 111 ? A HIS 111 28 5 Y 1 A HIS 112 ? A HIS 112 29 5 Y 1 A HIS 113 ? A HIS 113 30 5 Y 1 A HIS 114 ? A HIS 114 31 6 Y 1 A HIS 109 ? A HIS 109 32 6 Y 1 A HIS 110 ? A HIS 110 33 6 Y 1 A HIS 111 ? A HIS 111 34 6 Y 1 A HIS 112 ? A HIS 112 35 6 Y 1 A HIS 113 ? A HIS 113 36 6 Y 1 A HIS 114 ? A HIS 114 37 7 Y 1 A HIS 109 ? A HIS 109 38 7 Y 1 A HIS 110 ? A HIS 110 39 7 Y 1 A HIS 111 ? A HIS 111 40 7 Y 1 A HIS 112 ? A HIS 112 41 7 Y 1 A HIS 113 ? A HIS 113 42 7 Y 1 A HIS 114 ? A HIS 114 43 8 Y 1 A HIS 109 ? A HIS 109 44 8 Y 1 A HIS 110 ? A HIS 110 45 8 Y 1 A HIS 111 ? A HIS 111 46 8 Y 1 A HIS 112 ? A HIS 112 47 8 Y 1 A HIS 113 ? A HIS 113 48 8 Y 1 A HIS 114 ? A HIS 114 49 9 Y 1 A HIS 109 ? A HIS 109 50 9 Y 1 A HIS 110 ? A HIS 110 51 9 Y 1 A HIS 111 ? A HIS 111 52 9 Y 1 A HIS 112 ? A HIS 112 53 9 Y 1 A HIS 113 ? A HIS 113 54 9 Y 1 A HIS 114 ? A HIS 114 55 10 Y 1 A HIS 109 ? A HIS 109 56 10 Y 1 A HIS 110 ? A HIS 110 57 10 Y 1 A HIS 111 ? A HIS 111 58 10 Y 1 A HIS 112 ? A HIS 112 59 10 Y 1 A HIS 113 ? A HIS 113 60 10 Y 1 A HIS 114 ? A HIS 114 61 11 Y 1 A HIS 109 ? A HIS 109 62 11 Y 1 A HIS 110 ? A HIS 110 63 11 Y 1 A HIS 111 ? A HIS 111 64 11 Y 1 A HIS 112 ? A HIS 112 65 11 Y 1 A HIS 113 ? A HIS 113 66 11 Y 1 A HIS 114 ? A HIS 114 67 12 Y 1 A HIS 109 ? A HIS 109 68 12 Y 1 A HIS 110 ? A HIS 110 69 12 Y 1 A HIS 111 ? A HIS 111 70 12 Y 1 A HIS 112 ? A HIS 112 71 12 Y 1 A HIS 113 ? A HIS 113 72 12 Y 1 A HIS 114 ? A HIS 114 73 13 Y 1 A HIS 109 ? A HIS 109 74 13 Y 1 A HIS 110 ? A HIS 110 75 13 Y 1 A HIS 111 ? A HIS 111 76 13 Y 1 A HIS 112 ? A HIS 112 77 13 Y 1 A HIS 113 ? A HIS 113 78 13 Y 1 A HIS 114 ? A HIS 114 79 14 Y 1 A HIS 109 ? A HIS 109 80 14 Y 1 A HIS 110 ? A HIS 110 81 14 Y 1 A HIS 111 ? A HIS 111 82 14 Y 1 A HIS 112 ? A HIS 112 83 14 Y 1 A HIS 113 ? A HIS 113 84 14 Y 1 A HIS 114 ? A HIS 114 85 15 Y 1 A HIS 109 ? A HIS 109 86 15 Y 1 A HIS 110 ? A HIS 110 87 15 Y 1 A HIS 111 ? A HIS 111 88 15 Y 1 A HIS 112 ? A HIS 112 89 15 Y 1 A HIS 113 ? A HIS 113 90 15 Y 1 A HIS 114 ? A HIS 114 91 16 Y 1 A HIS 109 ? A HIS 109 92 16 Y 1 A HIS 110 ? A HIS 110 93 16 Y 1 A HIS 111 ? A HIS 111 94 16 Y 1 A HIS 112 ? A HIS 112 95 16 Y 1 A HIS 113 ? A HIS 113 96 16 Y 1 A HIS 114 ? A HIS 114 97 17 Y 1 A HIS 109 ? A HIS 109 98 17 Y 1 A HIS 110 ? A HIS 110 99 17 Y 1 A HIS 111 ? A HIS 111 100 17 Y 1 A HIS 112 ? A HIS 112 101 17 Y 1 A HIS 113 ? A HIS 113 102 17 Y 1 A HIS 114 ? A HIS 114 103 18 Y 1 A HIS 109 ? A HIS 109 104 18 Y 1 A HIS 110 ? A HIS 110 105 18 Y 1 A HIS 111 ? A HIS 111 106 18 Y 1 A HIS 112 ? A HIS 112 107 18 Y 1 A HIS 113 ? A HIS 113 108 18 Y 1 A HIS 114 ? A HIS 114 109 19 Y 1 A HIS 109 ? A HIS 109 110 19 Y 1 A HIS 110 ? A HIS 110 111 19 Y 1 A HIS 111 ? A HIS 111 112 19 Y 1 A HIS 112 ? A HIS 112 113 19 Y 1 A HIS 113 ? A HIS 113 114 19 Y 1 A HIS 114 ? A HIS 114 115 20 Y 1 A HIS 109 ? A HIS 109 116 20 Y 1 A HIS 110 ? A HIS 110 117 20 Y 1 A HIS 111 ? A HIS 111 118 20 Y 1 A HIS 112 ? A HIS 112 119 20 Y 1 A HIS 113 ? A HIS 113 120 20 Y 1 A HIS 114 ? A HIS 114 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 LEU N N N N 141 LEU CA C N S 142 LEU C C N N 143 LEU O O N N 144 LEU CB C N N 145 LEU CG C N N 146 LEU CD1 C N N 147 LEU CD2 C N N 148 LEU OXT O N N 149 LEU H H N N 150 LEU H2 H N N 151 LEU HA H N N 152 LEU HB2 H N N 153 LEU HB3 H N N 154 LEU HG H N N 155 LEU HD11 H N N 156 LEU HD12 H N N 157 LEU HD13 H N N 158 LEU HD21 H N N 159 LEU HD22 H N N 160 LEU HD23 H N N 161 LEU HXT H N N 162 LYS N N N N 163 LYS CA C N S 164 LYS C C N N 165 LYS O O N N 166 LYS CB C N N 167 LYS CG C N N 168 LYS CD C N N 169 LYS CE C N N 170 LYS NZ N N N 171 LYS OXT O N N 172 LYS H H N N 173 LYS H2 H N N 174 LYS HA H N N 175 LYS HB2 H N N 176 LYS HB3 H N N 177 LYS HG2 H N N 178 LYS HG3 H N N 179 LYS HD2 H N N 180 LYS HD3 H N N 181 LYS HE2 H N N 182 LYS HE3 H N N 183 LYS HZ1 H N N 184 LYS HZ2 H N N 185 LYS HZ3 H N N 186 LYS HXT H N N 187 MET N N N N 188 MET CA C N S 189 MET C C N N 190 MET O O N N 191 MET CB C N N 192 MET CG C N N 193 MET SD S N N 194 MET CE C N N 195 MET OXT O N N 196 MET H H N N 197 MET H2 H N N 198 MET HA H N N 199 MET HB2 H N N 200 MET HB3 H N N 201 MET HG2 H N N 202 MET HG3 H N N 203 MET HE1 H N N 204 MET HE2 H N N 205 MET HE3 H N N 206 MET HXT H N N 207 PHE N N N N 208 PHE CA C N S 209 PHE C C N N 210 PHE O O N N 211 PHE CB C N N 212 PHE CG C Y N 213 PHE CD1 C Y N 214 PHE CD2 C Y N 215 PHE CE1 C Y N 216 PHE CE2 C Y N 217 PHE CZ C Y N 218 PHE OXT O N N 219 PHE H H N N 220 PHE H2 H N N 221 PHE HA H N N 222 PHE HB2 H N N 223 PHE HB3 H N N 224 PHE HD1 H N N 225 PHE HD2 H N N 226 PHE HE1 H N N 227 PHE HE2 H N N 228 PHE HZ H N N 229 PHE HXT H N N 230 PRO N N N N 231 PRO CA C N S 232 PRO C C N N 233 PRO O O N N 234 PRO CB C N N 235 PRO CG C N N 236 PRO CD C N N 237 PRO OXT O N N 238 PRO H H N N 239 PRO HA H N N 240 PRO HB2 H N N 241 PRO HB3 H N N 242 PRO HG2 H N N 243 PRO HG3 H N N 244 PRO HD2 H N N 245 PRO HD3 H N N 246 PRO HXT H N N 247 SER N N N N 248 SER CA C N S 249 SER C C N N 250 SER O O N N 251 SER CB C N N 252 SER OG O N N 253 SER OXT O N N 254 SER H H N N 255 SER H2 H N N 256 SER HA H N N 257 SER HB2 H N N 258 SER HB3 H N N 259 SER HG H N N 260 SER HXT H N N 261 THR N N N N 262 THR CA C N S 263 THR C C N N 264 THR O O N N 265 THR CB C N R 266 THR OG1 O N N 267 THR CG2 C N N 268 THR OXT O N N 269 THR H H N N 270 THR H2 H N N 271 THR HA H N N 272 THR HB H N N 273 THR HG1 H N N 274 THR HG21 H N N 275 THR HG22 H N N 276 THR HG23 H N N 277 THR HXT H N N 278 TRP N N N N 279 TRP CA C N S 280 TRP C C N N 281 TRP O O N N 282 TRP CB C N N 283 TRP CG C Y N 284 TRP CD1 C Y N 285 TRP CD2 C Y N 286 TRP NE1 N Y N 287 TRP CE2 C Y N 288 TRP CE3 C Y N 289 TRP CZ2 C Y N 290 TRP CZ3 C Y N 291 TRP CH2 C Y N 292 TRP OXT O N N 293 TRP H H N N 294 TRP H2 H N N 295 TRP HA H N N 296 TRP HB2 H N N 297 TRP HB3 H N N 298 TRP HD1 H N N 299 TRP HE1 H N N 300 TRP HE3 H N N 301 TRP HZ2 H N N 302 TRP HZ3 H N N 303 TRP HH2 H N N 304 TRP HXT H N N 305 TYR N N N N 306 TYR CA C N S 307 TYR C C N N 308 TYR O O N N 309 TYR CB C N N 310 TYR CG C Y N 311 TYR CD1 C Y N 312 TYR CD2 C Y N 313 TYR CE1 C Y N 314 TYR CE2 C Y N 315 TYR CZ C Y N 316 TYR OH O N N 317 TYR OXT O N N 318 TYR H H N N 319 TYR H2 H N N 320 TYR HA H N N 321 TYR HB2 H N N 322 TYR HB3 H N N 323 TYR HD1 H N N 324 TYR HD2 H N N 325 TYR HE1 H N N 326 TYR HE2 H N N 327 TYR HH H N N 328 TYR HXT H N N 329 VAL N N N N 330 VAL CA C N S 331 VAL C C N N 332 VAL O O N N 333 VAL CB C N N 334 VAL CG1 C N N 335 VAL CG2 C N N 336 VAL OXT O N N 337 VAL H H N N 338 VAL H2 H N N 339 VAL HA H N N 340 VAL HB H N N 341 VAL HG11 H N N 342 VAL HG12 H N N 343 VAL HG13 H N N 344 VAL HG21 H N N 345 VAL HG22 H N N 346 VAL HG23 H N N 347 VAL HXT H N N 348 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 LEU N CA sing N N 134 LEU N H sing N N 135 LEU N H2 sing N N 136 LEU CA C sing N N 137 LEU CA CB sing N N 138 LEU CA HA sing N N 139 LEU C O doub N N 140 LEU C OXT sing N N 141 LEU CB CG sing N N 142 LEU CB HB2 sing N N 143 LEU CB HB3 sing N N 144 LEU CG CD1 sing N N 145 LEU CG CD2 sing N N 146 LEU CG HG sing N N 147 LEU CD1 HD11 sing N N 148 LEU CD1 HD12 sing N N 149 LEU CD1 HD13 sing N N 150 LEU CD2 HD21 sing N N 151 LEU CD2 HD22 sing N N 152 LEU CD2 HD23 sing N N 153 LEU OXT HXT sing N N 154 LYS N CA sing N N 155 LYS N H sing N N 156 LYS N H2 sing N N 157 LYS CA C sing N N 158 LYS CA CB sing N N 159 LYS CA HA sing N N 160 LYS C O doub N N 161 LYS C OXT sing N N 162 LYS CB CG sing N N 163 LYS CB HB2 sing N N 164 LYS CB HB3 sing N N 165 LYS CG CD sing N N 166 LYS CG HG2 sing N N 167 LYS CG HG3 sing N N 168 LYS CD CE sing N N 169 LYS CD HD2 sing N N 170 LYS CD HD3 sing N N 171 LYS CE NZ sing N N 172 LYS CE HE2 sing N N 173 LYS CE HE3 sing N N 174 LYS NZ HZ1 sing N N 175 LYS NZ HZ2 sing N N 176 LYS NZ HZ3 sing N N 177 LYS OXT HXT sing N N 178 MET N CA sing N N 179 MET N H sing N N 180 MET N H2 sing N N 181 MET CA C sing N N 182 MET CA CB sing N N 183 MET CA HA sing N N 184 MET C O doub N N 185 MET C OXT sing N N 186 MET CB CG sing N N 187 MET CB HB2 sing N N 188 MET CB HB3 sing N N 189 MET CG SD sing N N 190 MET CG HG2 sing N N 191 MET CG HG3 sing N N 192 MET SD CE sing N N 193 MET CE HE1 sing N N 194 MET CE HE2 sing N N 195 MET CE HE3 sing N N 196 MET OXT HXT sing N N 197 PHE N CA sing N N 198 PHE N H sing N N 199 PHE N H2 sing N N 200 PHE CA C sing N N 201 PHE CA CB sing N N 202 PHE CA HA sing N N 203 PHE C O doub N N 204 PHE C OXT sing N N 205 PHE CB CG sing N N 206 PHE CB HB2 sing N N 207 PHE CB HB3 sing N N 208 PHE CG CD1 doub Y N 209 PHE CG CD2 sing Y N 210 PHE CD1 CE1 sing Y N 211 PHE CD1 HD1 sing N N 212 PHE CD2 CE2 doub Y N 213 PHE CD2 HD2 sing N N 214 PHE CE1 CZ doub Y N 215 PHE CE1 HE1 sing N N 216 PHE CE2 CZ sing Y N 217 PHE CE2 HE2 sing N N 218 PHE CZ HZ sing N N 219 PHE OXT HXT sing N N 220 PRO N CA sing N N 221 PRO N CD sing N N 222 PRO N H sing N N 223 PRO CA C sing N N 224 PRO CA CB sing N N 225 PRO CA HA sing N N 226 PRO C O doub N N 227 PRO C OXT sing N N 228 PRO CB CG sing N N 229 PRO CB HB2 sing N N 230 PRO CB HB3 sing N N 231 PRO CG CD sing N N 232 PRO CG HG2 sing N N 233 PRO CG HG3 sing N N 234 PRO CD HD2 sing N N 235 PRO CD HD3 sing N N 236 PRO OXT HXT sing N N 237 SER N CA sing N N 238 SER N H sing N N 239 SER N H2 sing N N 240 SER CA C sing N N 241 SER CA CB sing N N 242 SER CA HA sing N N 243 SER C O doub N N 244 SER C OXT sing N N 245 SER CB OG sing N N 246 SER CB HB2 sing N N 247 SER CB HB3 sing N N 248 SER OG HG sing N N 249 SER OXT HXT sing N N 250 THR N CA sing N N 251 THR N H sing N N 252 THR N H2 sing N N 253 THR CA C sing N N 254 THR CA CB sing N N 255 THR CA HA sing N N 256 THR C O doub N N 257 THR C OXT sing N N 258 THR CB OG1 sing N N 259 THR CB CG2 sing N N 260 THR CB HB sing N N 261 THR OG1 HG1 sing N N 262 THR CG2 HG21 sing N N 263 THR CG2 HG22 sing N N 264 THR CG2 HG23 sing N N 265 THR OXT HXT sing N N 266 TRP N CA sing N N 267 TRP N H sing N N 268 TRP N H2 sing N N 269 TRP CA C sing N N 270 TRP CA CB sing N N 271 TRP CA HA sing N N 272 TRP C O doub N N 273 TRP C OXT sing N N 274 TRP CB CG sing N N 275 TRP CB HB2 sing N N 276 TRP CB HB3 sing N N 277 TRP CG CD1 doub Y N 278 TRP CG CD2 sing Y N 279 TRP CD1 NE1 sing Y N 280 TRP CD1 HD1 sing N N 281 TRP CD2 CE2 doub Y N 282 TRP CD2 CE3 sing Y N 283 TRP NE1 CE2 sing Y N 284 TRP NE1 HE1 sing N N 285 TRP CE2 CZ2 sing Y N 286 TRP CE3 CZ3 doub Y N 287 TRP CE3 HE3 sing N N 288 TRP CZ2 CH2 doub Y N 289 TRP CZ2 HZ2 sing N N 290 TRP CZ3 CH2 sing Y N 291 TRP CZ3 HZ3 sing N N 292 TRP CH2 HH2 sing N N 293 TRP OXT HXT sing N N 294 TYR N CA sing N N 295 TYR N H sing N N 296 TYR N H2 sing N N 297 TYR CA C sing N N 298 TYR CA CB sing N N 299 TYR CA HA sing N N 300 TYR C O doub N N 301 TYR C OXT sing N N 302 TYR CB CG sing N N 303 TYR CB HB2 sing N N 304 TYR CB HB3 sing N N 305 TYR CG CD1 doub Y N 306 TYR CG CD2 sing Y N 307 TYR CD1 CE1 sing Y N 308 TYR CD1 HD1 sing N N 309 TYR CD2 CE2 doub Y N 310 TYR CD2 HD2 sing N N 311 TYR CE1 CZ doub Y N 312 TYR CE1 HE1 sing N N 313 TYR CE2 CZ sing Y N 314 TYR CE2 HE2 sing N N 315 TYR CZ OH sing N N 316 TYR OH HH sing N N 317 TYR OXT HXT sing N N 318 VAL N CA sing N N 319 VAL N H sing N N 320 VAL N H2 sing N N 321 VAL CA C sing N N 322 VAL CA CB sing N N 323 VAL CA HA sing N N 324 VAL C O doub N N 325 VAL C OXT sing N N 326 VAL CB CG1 sing N N 327 VAL CB CG2 sing N N 328 VAL CB HB sing N N 329 VAL CG1 HG11 sing N N 330 VAL CG1 HG12 sing N N 331 VAL CG1 HG13 sing N N 332 VAL CG2 HG21 sing N N 333 VAL CG2 HG22 sing N N 334 VAL CG2 HG23 sing N N 335 VAL OXT HXT sing N N 336 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2LRC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_