data_2LWR # _entry.id 2LWR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LWR pdb_00002lwr 10.2210/pdb2lwr/pdb RCSB RCSB102928 ? ? BMRB 18642 ? 10.13018/BMR18642 WWPDB D_1000102928 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-06-12 2 'Structure model' 1 1 2013-07-03 3 'Structure model' 1 2 2014-10-15 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 32 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LWR _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-08-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2JMO PDB 'Parkin in-between RING domain' unspecified 15074 BMRB 'Parkin in-between RING domain' unspecified 18642 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mercier, P.' 1 'Spratt, D.E.' 2 'Manczyk, N.' 3 'Shaw, G.S.' 4 # _citation.id primary _citation.title ;A molecular explanation for the recessive nature of parkin-linked Parkinson's disease. ; _citation.journal_abbrev 'Nat Commun' _citation.journal_volume 4 _citation.page_first 1983 _citation.page_last 1983 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23770917 _citation.pdbx_database_id_DOI 10.1038/ncomms2983 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Spratt, D.E.' 1 ? primary 'Julio Martinez-Torres, R.' 2 ? primary 'Noh, Y.J.' 3 ? primary 'Mercier, P.' 4 ? primary 'Manczyk, N.' 5 ? primary 'Barber, K.R.' 6 ? primary 'Aguirre, J.D.' 7 ? primary 'Burchell, L.' 8 ? primary 'Purkiss, A.' 9 ? primary 'Walden, H.' 10 ? primary 'Shaw, G.S.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man SD01679p 7669.745 1 ? ? 'UNP residues 417-482' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'E3 ubiquitin-protein ligase parkin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSAEARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEWTRDCMGAHWFG _entity_poly.pdbx_seq_one_letter_code_can GSAEARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEWTRDCMGAHWFG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 GLU n 1 5 ALA n 1 6 ARG n 1 7 TRP n 1 8 ASP n 1 9 GLU n 1 10 ALA n 1 11 SER n 1 12 ASN n 1 13 VAL n 1 14 THR n 1 15 ILE n 1 16 LYS n 1 17 VAL n 1 18 SER n 1 19 THR n 1 20 LYS n 1 21 PRO n 1 22 CYS n 1 23 PRO n 1 24 LYS n 1 25 CYS n 1 26 ARG n 1 27 THR n 1 28 PRO n 1 29 THR n 1 30 GLU n 1 31 ARG n 1 32 ASP n 1 33 GLY n 1 34 GLY n 1 35 CYS n 1 36 MET n 1 37 HIS n 1 38 MET n 1 39 VAL n 1 40 CYS n 1 41 THR n 1 42 ARG n 1 43 ALA n 1 44 GLY n 1 45 CYS n 1 46 GLY n 1 47 PHE n 1 48 GLU n 1 49 TRP n 1 50 CYS n 1 51 TRP n 1 52 VAL n 1 53 CYS n 1 54 GLN n 1 55 THR n 1 56 GLU n 1 57 TRP n 1 58 THR n 1 59 ARG n 1 60 ASP n 1 61 CYS n 1 62 MET n 1 63 GLY n 1 64 ALA n 1 65 HIS n 1 66 TRP n 1 67 PHE n 1 68 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Fruit fly' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'park, CG10523' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEX-6P-2 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'GST-fusion protein with TEV cleavable tag.' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 1 GLY GLY A . n A 1 2 SER 2 0 2 SER SER A . n A 1 3 ALA 3 417 3 ALA ALA A . n A 1 4 GLU 4 418 4 GLU GLU A . n A 1 5 ALA 5 419 5 ALA ALA A . n A 1 6 ARG 6 420 6 ARG ARG A . n A 1 7 TRP 7 421 7 TRP TRP A . n A 1 8 ASP 8 422 8 ASP ASP A . n A 1 9 GLU 9 423 9 GLU GLU A . n A 1 10 ALA 10 424 10 ALA ALA A . n A 1 11 SER 11 425 11 SER SER A . n A 1 12 ASN 12 426 12 ASN ASN A . n A 1 13 VAL 13 427 13 VAL VAL A . n A 1 14 THR 14 428 14 THR THR A . n A 1 15 ILE 15 429 15 ILE ILE A . n A 1 16 LYS 16 430 16 LYS LYS A . n A 1 17 VAL 17 431 17 VAL VAL A . n A 1 18 SER 18 432 18 SER SER A . n A 1 19 THR 19 433 19 THR THR A . n A 1 20 LYS 20 434 20 LYS LYS A . n A 1 21 PRO 21 435 21 PRO PRO A . n A 1 22 CYS 22 436 22 CYS CYS A . n A 1 23 PRO 23 437 23 PRO PRO A . n A 1 24 LYS 24 438 24 LYS LYS A . n A 1 25 CYS 25 439 25 CYS CYS A . n A 1 26 ARG 26 440 26 ARG ARG A . n A 1 27 THR 27 441 27 THR THR A . n A 1 28 PRO 28 442 28 PRO PRO A . n A 1 29 THR 29 443 29 THR THR A . n A 1 30 GLU 30 444 30 GLU GLU A . n A 1 31 ARG 31 445 31 ARG ARG A . n A 1 32 ASP 32 446 32 ASP ASP A . n A 1 33 GLY 33 447 33 GLY GLY A . n A 1 34 GLY 34 448 34 GLY GLY A . n A 1 35 CYS 35 449 35 CYS CYS A . n A 1 36 MET 36 450 36 MET MET A . n A 1 37 HIS 37 451 37 HIS HIS A . n A 1 38 MET 38 452 38 MET MET A . n A 1 39 VAL 39 453 39 VAL VAL A . n A 1 40 CYS 40 454 40 CYS CYS A . n A 1 41 THR 41 455 41 THR THR A . n A 1 42 ARG 42 456 42 ARG ARG A . n A 1 43 ALA 43 457 43 ALA ALA A . n A 1 44 GLY 44 458 44 GLY GLY A . n A 1 45 CYS 45 459 45 CYS CYS A . n A 1 46 GLY 46 460 46 GLY GLY A . n A 1 47 PHE 47 461 47 PHE PHE A . n A 1 48 GLU 48 462 48 GLU GLU A . n A 1 49 TRP 49 463 49 TRP TRP A . n A 1 50 CYS 50 464 50 CYS CYS A . n A 1 51 TRP 51 465 51 TRP TRP A . n A 1 52 VAL 52 466 52 VAL VAL A . n A 1 53 CYS 53 467 53 CYS CYS A . n A 1 54 GLN 54 468 54 GLN GLN A . n A 1 55 THR 55 469 55 THR THR A . n A 1 56 GLU 56 470 56 GLU GLU A . n A 1 57 TRP 57 471 57 TRP TRP A . n A 1 58 THR 58 472 58 THR THR A . n A 1 59 ARG 59 473 59 ARG ARG A . n A 1 60 ASP 60 474 60 ASP ASP A . n A 1 61 CYS 61 475 61 CYS CYS A . n A 1 62 MET 62 476 62 MET MET A . n A 1 63 GLY 63 477 63 GLY GLY A . n A 1 64 ALA 64 478 64 ALA ALA A . n A 1 65 HIS 65 479 65 HIS HIS A . n A 1 66 TRP 66 480 66 TRP TRP A . n A 1 67 PHE 67 481 67 PHE PHE A . n A 1 68 GLY 68 482 68 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1 1 ZN ZN2 A . C 2 ZN 1 2 2 ZN ZN2 A . # _cell.entry_id 2LWR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2LWR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LWR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LWR _struct.title 'Solution Structure of RING2 Domain from Parkin' _struct.pdbx_model_details 'closest to the average, model 3' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LWR _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'Parkin, RING, E3 ligase, Zn-binding, METAL BINDING PROTEIN, STRUCTURAL PROTEIN, LIGASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q95TI4_DROME _struct_ref.pdbx_db_accession Q95TI4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AEARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGCGFEWCWVCQTEWTRDCMGAHWFG _struct_ref.pdbx_align_begin 417 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LWR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q95TI4 _struct_ref_seq.db_align_beg 417 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 482 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 417 _struct_ref_seq.pdbx_auth_seq_align_end 482 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LWR GLY A 1 ? UNP Q95TI4 ? ? 'expression tag' -1 1 1 2LWR SER A 2 ? UNP Q95TI4 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 22 SG ? ? A ZN 1 A CYS 436 1_555 ? ? ? ? ? ? ? 2.343 ? ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 25 SG ? ? A ZN 1 A CYS 439 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 40 SG ? ? A ZN 1 A CYS 454 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 45 SG ? ? A ZN 1 A CYS 459 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 50 SG ? ? A ZN 2 A CYS 464 1_555 ? ? ? ? ? ? ? 2.225 ? ? metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 53 SG ? ? A ZN 2 A CYS 467 1_555 ? ? ? ? ? ? ? 2.241 ? ? metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 61 SG ? ? A ZN 2 A CYS 475 1_555 ? ? ? ? ? ? ? 2.157 ? ? metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 65 NE2 ? ? A ZN 2 A HIS 479 1_555 ? ? ? ? ? ? ? 2.465 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 22 ? A CYS 436 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 25 ? A CYS 439 ? 1_555 103.9 ? 2 SG ? A CYS 22 ? A CYS 436 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 40 ? A CYS 454 ? 1_555 105.9 ? 3 SG ? A CYS 25 ? A CYS 439 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 40 ? A CYS 454 ? 1_555 120.9 ? 4 SG ? A CYS 22 ? A CYS 436 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 45 ? A CYS 459 ? 1_555 122.8 ? 5 SG ? A CYS 25 ? A CYS 439 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 45 ? A CYS 459 ? 1_555 101.1 ? 6 SG ? A CYS 40 ? A CYS 454 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG ? A CYS 45 ? A CYS 459 ? 1_555 103.6 ? 7 SG ? A CYS 50 ? A CYS 464 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 53 ? A CYS 467 ? 1_555 112.7 ? 8 SG ? A CYS 50 ? A CYS 464 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 61 ? A CYS 475 ? 1_555 119.0 ? 9 SG ? A CYS 53 ? A CYS 467 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 SG ? A CYS 61 ? A CYS 475 ? 1_555 115.9 ? 10 SG ? A CYS 50 ? A CYS 464 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 NE2 ? A HIS 65 ? A HIS 479 ? 1_555 124.2 ? 11 SG ? A CYS 53 ? A CYS 467 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 NE2 ? A HIS 65 ? A HIS 479 ? 1_555 91.5 ? 12 SG ? A CYS 61 ? A CYS 475 ? 1_555 ZN ? C ZN . ? A ZN 2 ? 1_555 NE2 ? A HIS 65 ? A HIS 479 ? 1_555 89.0 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 19 ? PRO A 21 ? THR A 433 PRO A 435 A 2 PRO A 28 ? GLU A 30 ? PRO A 442 GLU A 444 B 1 CYS A 35 ? MET A 36 ? CYS A 449 MET A 450 B 2 TRP A 66 ? PHE A 67 ? TRP A 480 PHE A 481 C 1 MET A 38 ? VAL A 39 ? MET A 452 VAL A 453 C 2 GLU A 48 ? TRP A 49 ? GLU A 462 TRP A 463 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 20 ? N LYS A 434 O THR A 29 ? O THR A 443 B 1 2 N MET A 36 ? N MET A 450 O TRP A 66 ? O TRP A 480 C 1 2 N MET A 38 ? N MET A 452 O TRP A 49 ? O TRP A 463 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 1 ? 4 'BINDING SITE FOR RESIDUE ZN A 1' AC2 Software A ZN 2 ? 5 'BINDING SITE FOR RESIDUE ZN A 2' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 22 ? CYS A 436 . ? 1_555 ? 2 AC1 4 CYS A 25 ? CYS A 439 . ? 1_555 ? 3 AC1 4 CYS A 40 ? CYS A 454 . ? 1_555 ? 4 AC1 4 CYS A 45 ? CYS A 459 . ? 1_555 ? 5 AC2 5 CYS A 50 ? CYS A 464 . ? 1_555 ? 6 AC2 5 CYS A 53 ? CYS A 467 . ? 1_555 ? 7 AC2 5 THR A 58 ? THR A 472 . ? 1_555 ? 8 AC2 5 CYS A 61 ? CYS A 475 . ? 1_555 ? 9 AC2 5 HIS A 65 ? HIS A 479 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 12 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 VAL _pdbx_validate_close_contact.auth_seq_id_1 431 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HZ1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 434 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 431 ? ? -176.39 147.05 2 1 CYS A 459 ? ? -105.70 -82.80 3 1 TRP A 465 ? ? 19.30 -74.96 4 1 THR A 469 ? ? -168.82 -148.60 5 1 HIS A 479 ? ? -88.06 -154.79 6 1 TRP A 480 ? ? 73.38 -53.01 7 2 SER A 425 ? ? -79.29 -79.36 8 2 PRO A 442 ? ? -69.62 90.81 9 2 CYS A 459 ? ? -120.00 -67.38 10 2 TRP A 480 ? ? -104.94 -88.61 11 3 THR A 428 ? ? -155.06 16.67 12 3 LYS A 430 ? ? -70.52 -79.10 13 3 LYS A 438 ? ? -110.20 -74.58 14 3 PRO A 442 ? ? -63.39 99.52 15 3 MET A 450 ? ? -99.50 33.78 16 3 CYS A 459 ? ? -85.56 -76.60 17 3 ALA A 478 ? ? -148.77 33.42 18 3 HIS A 479 ? ? -149.81 -9.10 19 3 PHE A 481 ? ? 175.72 -44.54 20 4 ASN A 426 ? ? -85.50 -77.59 21 4 THR A 428 ? ? 178.94 163.64 22 4 PRO A 442 ? ? -57.91 108.64 23 4 ASP A 446 ? ? -28.37 106.98 24 4 MET A 450 ? ? 71.75 -7.90 25 4 CYS A 459 ? ? -129.77 -78.04 26 4 GLN A 468 ? ? -146.18 17.05 27 4 HIS A 479 ? ? -104.60 -71.88 28 4 PHE A 481 ? ? 80.25 -20.03 29 5 THR A 428 ? ? -175.17 -20.49 30 5 LYS A 438 ? ? -109.43 -76.17 31 5 MET A 450 ? ? -77.31 48.65 32 5 CYS A 459 ? ? -141.00 -61.55 33 5 HIS A 479 ? ? -94.58 -66.78 34 6 ALA A 417 ? ? -151.19 25.94 35 6 LYS A 438 ? ? -108.38 -61.21 36 6 PRO A 442 ? ? -66.25 93.46 37 6 CYS A 459 ? ? -131.08 -75.43 38 6 GLN A 468 ? ? -141.09 26.41 39 6 THR A 469 ? ? -111.94 -73.43 40 6 THR A 472 ? ? 69.81 126.02 41 6 HIS A 479 ? ? -153.76 -75.01 42 7 GLU A 423 ? ? -91.92 -69.06 43 7 ALA A 424 ? ? -170.46 131.85 44 7 SER A 432 ? ? 64.49 -168.63 45 7 LYS A 438 ? ? -105.50 -64.15 46 7 PRO A 442 ? ? -65.03 88.38 47 7 CYS A 459 ? ? -97.98 -82.04 48 7 THR A 469 ? ? -141.16 -136.17 49 7 TRP A 471 ? ? -55.90 101.94 50 7 HIS A 479 ? ? -142.07 -74.56 51 7 TRP A 480 ? ? -41.39 104.84 52 7 PHE A 481 ? ? 51.64 17.19 53 8 ALA A 419 ? ? -117.66 -163.37 54 8 ALA A 424 ? ? -92.01 31.73 55 8 SER A 425 ? ? -92.18 31.28 56 8 LYS A 430 ? ? -149.89 -85.54 57 8 PRO A 442 ? ? -63.98 98.87 58 8 GLU A 444 ? ? -58.68 108.97 59 8 CYS A 459 ? ? -107.84 -83.35 60 8 GLN A 468 ? ? -146.23 21.27 61 8 HIS A 479 ? ? -96.59 -74.13 62 8 PHE A 481 ? ? 78.99 -38.44 63 9 LYS A 438 ? ? -124.68 -54.79 64 9 PRO A 442 ? ? -69.45 95.01 65 9 CYS A 459 ? ? -107.94 -89.22 66 9 GLN A 468 ? ? -169.15 22.51 67 9 THR A 469 ? ? -99.49 -69.43 68 9 HIS A 479 ? ? -130.57 -70.52 69 10 ALA A 424 ? ? -164.25 27.88 70 10 LYS A 438 ? ? -111.01 -75.41 71 10 PRO A 442 ? ? -69.17 96.39 72 10 CYS A 459 ? ? -91.20 -79.06 73 10 GLN A 468 ? ? -78.83 47.94 74 10 TRP A 471 ? ? -69.66 86.89 75 10 HIS A 479 ? ? -106.48 -108.53 76 10 TRP A 480 ? ? 61.39 -74.66 77 11 ILE A 429 ? ? -146.20 -46.35 78 11 LYS A 438 ? ? -108.48 -61.94 79 11 PRO A 442 ? ? -66.46 91.01 80 11 CYS A 459 ? ? -100.92 -73.32 81 11 ARG A 473 ? ? 70.46 -32.67 82 11 HIS A 479 ? ? -129.16 -63.02 83 11 TRP A 480 ? ? -13.35 -66.17 84 12 ASP A 422 ? ? 49.78 92.42 85 12 PRO A 442 ? ? -66.84 93.11 86 12 CYS A 459 ? ? -82.46 -74.52 87 12 THR A 469 ? ? -109.46 -166.21 88 12 TRP A 480 ? ? -69.19 1.93 89 12 PHE A 481 ? ? -162.54 65.46 90 13 ARG A 420 ? ? 70.54 -15.91 91 13 LYS A 438 ? ? -106.88 -74.11 92 13 CYS A 459 ? ? -93.45 -82.01 93 13 HIS A 479 ? ? -122.41 -165.49 94 13 PHE A 481 ? ? -141.67 -46.07 95 14 LYS A 438 ? ? -109.48 -74.41 96 14 MET A 450 ? ? -94.78 39.19 97 14 CYS A 459 ? ? -82.85 -71.81 98 14 TRP A 480 ? ? -21.64 -73.66 99 15 PRO A 442 ? ? -64.82 98.20 100 15 MET A 450 ? ? -83.30 31.00 101 15 ALA A 457 ? ? -58.40 105.87 102 15 CYS A 459 ? ? -93.51 -71.31 103 15 TRP A 465 ? ? 6.58 -75.00 104 15 TRP A 480 ? ? -52.78 97.95 105 16 SER A 432 ? ? 70.59 -89.99 106 16 PRO A 442 ? ? -64.73 96.30 107 16 MET A 450 ? ? -99.67 38.03 108 16 CYS A 454 ? ? -69.09 99.71 109 16 CYS A 459 ? ? -145.25 -76.66 110 16 TRP A 480 ? ? -49.19 98.93 111 17 SER A 0 ? ? -153.45 -30.32 112 17 PRO A 442 ? ? -64.55 97.96 113 17 ASP A 446 ? ? -25.60 105.59 114 17 CYS A 459 ? ? -105.66 -72.70 115 17 ARG A 473 ? ? 74.84 -28.75 116 17 TRP A 480 ? ? -76.01 -163.32 117 18 ASP A 422 ? ? -165.13 116.84 118 18 PRO A 442 ? ? -66.61 92.04 119 18 GLU A 444 ? ? -58.47 102.48 120 18 MET A 450 ? ? -86.30 30.97 121 18 CYS A 459 ? ? -144.10 -76.53 122 18 GLN A 468 ? ? -87.51 31.98 123 18 HIS A 479 ? ? -99.02 -72.10 124 19 THR A 428 ? ? -67.49 87.56 125 19 ILE A 429 ? ? -167.16 109.93 126 19 PRO A 442 ? ? -66.94 92.90 127 19 MET A 450 ? ? -87.63 31.73 128 19 CYS A 459 ? ? -88.32 -70.16 129 19 THR A 469 ? ? -170.64 -173.23 130 19 HIS A 479 ? ? -174.92 -37.72 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.34 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 19 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LWR _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 4.2 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.57 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.042 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.003 _pdbx_nmr_ensemble_rms.entry_id 2LWR _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LWR _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '20 mM TRIS, 120 mM sodium chloride, 5 mM DTT, 500 uM [U-98% 15N] protein_1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '20 mM TRIS, 120 mM sodium chloride, 5 mM DTT, 500 uM [U-98% 13C; U-98% 15N] protein_1, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '20 mM TRIS, 120 mM sodium chloride, 5 mM DTT, 500 uM [U-98% 13C; U-98% 15N] protein_1, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id TRIS-1 20 ? mM ? 1 'sodium chloride-2' 120 ? mM ? 1 DTT-3 5 ? mM ? 1 entity_1-4 500 ? uM '[U-98% 15N]' 1 TRIS-5 20 ? mM ? 2 'sodium chloride-6' 120 ? mM ? 2 DTT-7 5 ? mM ? 2 entity_1-8 500 ? uM '[U-98% 13C; U-98% 15N]' 2 TRIS-9 20 ? mM ? 3 'sodium chloride-10' 120 ? mM ? 3 DTT-11 5 ? mM ? 3 entity_1-12 500 ? uM '[U-98% 13C; U-98% 15N]' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.120 _pdbx_nmr_exptl_sample_conditions.pH 7.25 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 3 '2D 1H-13C HSQC aliphatic' 1 3 3 '2D 1H-13C HSQC aromatic' 1 4 1 '3D 1H-15N NOESY' 1 5 3 '3D HCCH-TOCSY' 1 6 3 '3D 1H-13C NOESY aliphatic' 1 7 2 '3D 1H-13C NOESY aromatic' 1 8 2 '3D HNCA' 1 9 2 '3D HN(CO)CA' 1 10 2 '3D HNCACB' 1 11 2 '3D CBCA(CO)NH' 1 12 2 '3D HNCO' 1 13 2 '3D HNHA' 1 14 2 '3D C(CO)NH' 1 15 2 '3D 1H-13C NOESY aliphatic' 1 16 2 '2D (HB)CB(CGCD)HD' 1 17 2 '2D (HB)CB(CGCDCE)HE' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LWR _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 575 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 165 _pdbx_nmr_constraints.NOE_long_range_total_count 187 _pdbx_nmr_constraints.NOE_medium_range_total_count 72 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 151 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 11 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 11 # _pdbx_nmr_refine.entry_id 2LWR _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'WITH EXPLICIT SOLVENT AND FULL ELECTROSTATICS' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ 'Varian VnmrJ 2.2D' 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2011.084.20.33 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw 'Ver 5.7 Rev 2011.084.20.33' 3 'Johnson, One Moon Scientific' 'data analysis' NMRView '8.2.33 with Java 1.6.0_31' 4 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView '8.2.33 with Java 1.6.0_31' 5 'Johnson, One Moon Scientific' 'peak picking' NMRView '8.2.33 with Java 1.6.0_31' 6 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 7 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.31 8 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS TALOSPlus 9 'Laskowski, MacArthur, Smith, Jones, Hutchinson, Morris, Moss and Tho' 'data analysis' Procheck 3.5.4 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 MET N N N N 205 MET CA C N S 206 MET C C N N 207 MET O O N N 208 MET CB C N N 209 MET CG C N N 210 MET SD S N N 211 MET CE C N N 212 MET OXT O N N 213 MET H H N N 214 MET H2 H N N 215 MET HA H N N 216 MET HB2 H N N 217 MET HB3 H N N 218 MET HG2 H N N 219 MET HG3 H N N 220 MET HE1 H N N 221 MET HE2 H N N 222 MET HE3 H N N 223 MET HXT H N N 224 PHE N N N N 225 PHE CA C N S 226 PHE C C N N 227 PHE O O N N 228 PHE CB C N N 229 PHE CG C Y N 230 PHE CD1 C Y N 231 PHE CD2 C Y N 232 PHE CE1 C Y N 233 PHE CE2 C Y N 234 PHE CZ C Y N 235 PHE OXT O N N 236 PHE H H N N 237 PHE H2 H N N 238 PHE HA H N N 239 PHE HB2 H N N 240 PHE HB3 H N N 241 PHE HD1 H N N 242 PHE HD2 H N N 243 PHE HE1 H N N 244 PHE HE2 H N N 245 PHE HZ H N N 246 PHE HXT H N N 247 PRO N N N N 248 PRO CA C N S 249 PRO C C N N 250 PRO O O N N 251 PRO CB C N N 252 PRO CG C N N 253 PRO CD C N N 254 PRO OXT O N N 255 PRO H H N N 256 PRO HA H N N 257 PRO HB2 H N N 258 PRO HB3 H N N 259 PRO HG2 H N N 260 PRO HG3 H N N 261 PRO HD2 H N N 262 PRO HD3 H N N 263 PRO HXT H N N 264 SER N N N N 265 SER CA C N S 266 SER C C N N 267 SER O O N N 268 SER CB C N N 269 SER OG O N N 270 SER OXT O N N 271 SER H H N N 272 SER H2 H N N 273 SER HA H N N 274 SER HB2 H N N 275 SER HB3 H N N 276 SER HG H N N 277 SER HXT H N N 278 THR N N N N 279 THR CA C N S 280 THR C C N N 281 THR O O N N 282 THR CB C N R 283 THR OG1 O N N 284 THR CG2 C N N 285 THR OXT O N N 286 THR H H N N 287 THR H2 H N N 288 THR HA H N N 289 THR HB H N N 290 THR HG1 H N N 291 THR HG21 H N N 292 THR HG22 H N N 293 THR HG23 H N N 294 THR HXT H N N 295 TRP N N N N 296 TRP CA C N S 297 TRP C C N N 298 TRP O O N N 299 TRP CB C N N 300 TRP CG C Y N 301 TRP CD1 C Y N 302 TRP CD2 C Y N 303 TRP NE1 N Y N 304 TRP CE2 C Y N 305 TRP CE3 C Y N 306 TRP CZ2 C Y N 307 TRP CZ3 C Y N 308 TRP CH2 C Y N 309 TRP OXT O N N 310 TRP H H N N 311 TRP H2 H N N 312 TRP HA H N N 313 TRP HB2 H N N 314 TRP HB3 H N N 315 TRP HD1 H N N 316 TRP HE1 H N N 317 TRP HE3 H N N 318 TRP HZ2 H N N 319 TRP HZ3 H N N 320 TRP HH2 H N N 321 TRP HXT H N N 322 VAL N N N N 323 VAL CA C N S 324 VAL C C N N 325 VAL O O N N 326 VAL CB C N N 327 VAL CG1 C N N 328 VAL CG2 C N N 329 VAL OXT O N N 330 VAL H H N N 331 VAL H2 H N N 332 VAL HA H N N 333 VAL HB H N N 334 VAL HG11 H N N 335 VAL HG12 H N N 336 VAL HG13 H N N 337 VAL HG21 H N N 338 VAL HG22 H N N 339 VAL HG23 H N N 340 VAL HXT H N N 341 ZN ZN ZN N N 342 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 VAL N CA sing N N 311 VAL N H sing N N 312 VAL N H2 sing N N 313 VAL CA C sing N N 314 VAL CA CB sing N N 315 VAL CA HA sing N N 316 VAL C O doub N N 317 VAL C OXT sing N N 318 VAL CB CG1 sing N N 319 VAL CB CG2 sing N N 320 VAL CB HB sing N N 321 VAL CG1 HG11 sing N N 322 VAL CG1 HG12 sing N N 323 VAL CG1 HG13 sing N N 324 VAL CG2 HG21 sing N N 325 VAL CG2 HG22 sing N N 326 VAL CG2 HG23 sing N N 327 VAL OXT HXT sing N N 328 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2LWR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_