data_2M2V # _entry.id 2M2V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M2V pdb_00002m2v 10.2210/pdb2m2v/pdb RCSB RCSB103139 ? ? BMRB 18935 ? ? WWPDB D_1000103139 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 18935 BMRB unspecified . 2M2T PDB unspecified . 2M2U PDB unspecified . 2M2W PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M2V _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-01-03 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, W.' 1 'Su, M.' 2 'Tsai, M.' 3 # _citation.id primary _citation.title 'How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 136 _citation.page_first 4927 _citation.page_last 4937 _citation.year 2014 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24617852 _citation.pdbx_database_id_DOI 10.1021/ja4102375 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, W.J.' 1 ? primary 'Su, M.I.' 2 ? primary 'Wu, J.L.' 3 ? primary 'Kumar, S.' 4 ? primary 'Lim, L.H.' 5 ? primary 'Wang, C.W.' 6 ? primary 'Nelissen, F.H.' 7 ? primary 'Chen, M.C.' 8 ? primary 'Doreleijers, J.F.' 9 ? primary 'Wijmenga, S.S.' 10 ? primary 'Tsai, M.D.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Repair DNA polymerase X' _entity.formula_weight 20351.488 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.7.7 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Pol X' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKV CGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELI KELGFTYRIPKKRL ; _entity_poly.pdbx_seq_one_letter_code_can ;MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKV CGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELI KELGFTYRIPKKRL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 THR n 1 4 LEU n 1 5 ILE n 1 6 GLN n 1 7 GLY n 1 8 LYS n 1 9 LYS n 1 10 ILE n 1 11 VAL n 1 12 ASN n 1 13 HIS n 1 14 LEU n 1 15 ARG n 1 16 SER n 1 17 ARG n 1 18 LEU n 1 19 ALA n 1 20 PHE n 1 21 GLU n 1 22 TYR n 1 23 ASN n 1 24 GLY n 1 25 GLN n 1 26 LEU n 1 27 ILE n 1 28 LYS n 1 29 ILE n 1 30 LEU n 1 31 SER n 1 32 LYS n 1 33 ASN n 1 34 ILE n 1 35 VAL n 1 36 ALA n 1 37 VAL n 1 38 GLY n 1 39 SER n 1 40 LEU n 1 41 ARG n 1 42 ARG n 1 43 GLU n 1 44 GLU n 1 45 LYS n 1 46 MET n 1 47 LEU n 1 48 ASN n 1 49 ASP n 1 50 VAL n 1 51 ASP n 1 52 LEU n 1 53 LEU n 1 54 ILE n 1 55 ILE n 1 56 VAL n 1 57 PRO n 1 58 GLU n 1 59 LYS n 1 60 LYS n 1 61 LEU n 1 62 LEU n 1 63 LYS n 1 64 HIS n 1 65 VAL n 1 66 LEU n 1 67 PRO n 1 68 ASN n 1 69 ILE n 1 70 ARG n 1 71 ILE n 1 72 LYS n 1 73 GLY n 1 74 LEU n 1 75 SER n 1 76 PHE n 1 77 SER n 1 78 VAL n 1 79 LYS n 1 80 VAL n 1 81 CYS n 1 82 GLY n 1 83 GLU n 1 84 ARG n 1 85 LYS n 1 86 CYS n 1 87 VAL n 1 88 LEU n 1 89 PHE n 1 90 ILE n 1 91 GLU n 1 92 TRP n 1 93 GLU n 1 94 LYS n 1 95 LYS n 1 96 THR n 1 97 TYR n 1 98 GLN n 1 99 LEU n 1 100 ASP n 1 101 LEU n 1 102 PHE n 1 103 THR n 1 104 ALA n 1 105 LEU n 1 106 ALA n 1 107 GLU n 1 108 GLU n 1 109 LYS n 1 110 PRO n 1 111 TYR n 1 112 ALA n 1 113 ILE n 1 114 PHE n 1 115 HIS n 1 116 PHE n 1 117 THR n 1 118 GLY n 1 119 PRO n 1 120 VAL n 1 121 SER n 1 122 TYR n 1 123 LEU n 1 124 ILE n 1 125 ARG n 1 126 ILE n 1 127 ARG n 1 128 ALA n 1 129 ALA n 1 130 LEU n 1 131 LYS n 1 132 LYS n 1 133 LYS n 1 134 ASN n 1 135 TYR n 1 136 LYS n 1 137 LEU n 1 138 ASN n 1 139 GLN n 1 140 TYR n 1 141 GLY n 1 142 LEU n 1 143 PHE n 1 144 LYS n 1 145 ASN n 1 146 GLN n 1 147 THR n 1 148 LEU n 1 149 VAL n 1 150 PRO n 1 151 LEU n 1 152 LYS n 1 153 ILE n 1 154 THR n 1 155 THR n 1 156 GLU n 1 157 LYS n 1 158 GLU n 1 159 LEU n 1 160 ILE n 1 161 LYS n 1 162 GLU n 1 163 LEU n 1 164 GLY n 1 165 PHE n 1 166 THR n 1 167 TYR n 1 168 ARG n 1 169 ILE n 1 170 PRO n 1 171 LYS n 1 172 LYS n 1 173 ARG n 1 174 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'African swine fever virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10497 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-17b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DPOLX_ASFB7 _struct_ref.pdbx_db_accession P42494 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKV CGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELI KELGFTYRIPKKRL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M2V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 174 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42494 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 174 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY' 1 8 1 '3D HN(CO)CA' 1 9 1 '3D HMCMCGCBCA' 1 10 1 '3D HN(COCA)CB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 250 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.5 mM ILV-CH3-[U-13C; U-15N; U-2H] protein, 10 mM Mg, 4 mM dGTP, 0.6 mM [U-100% 13C; U-100% 15N] DNA, 50 mM Borate, 10 mM [U-2H] DTT, 200 mM potassium chloride, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 850 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' 600 Bruker AVANCE 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2M2V _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 2000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M2V _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M2V _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Dr. Alexandre Bonvin' refinement HADDOCK ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M2V _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M2V _struct.title 'African Swine Fever Virus Pol X in the ternary complex with MgdGTP and DNA' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M2V _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'DNA polymerase, Nucleotidyl Transferase, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 4 ? LEU A 18 ? LEU A 4 LEU A 18 1 ? 15 HELX_P HELX_P2 2 LEU A 30 ? LYS A 32 ? LEU A 30 LYS A 32 5 ? 3 HELX_P HELX_P3 3 GLY A 38 ? GLU A 43 ? GLY A 38 GLU A 43 1 ? 6 HELX_P HELX_P4 4 LYS A 60 ? VAL A 65 ? LYS A 60 VAL A 65 1 ? 6 HELX_P HELX_P5 5 GLU A 108 ? GLY A 118 ? GLU A 108 GLY A 118 1 ? 11 HELX_P HELX_P6 6 PRO A 119 ? LYS A 132 ? PRO A 119 LYS A 132 1 ? 14 HELX_P HELX_P7 7 THR A 155 ? GLY A 164 ? THR A 155 GLY A 164 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? C ? 5 ? D ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? parallel C 3 4 ? anti-parallel C 4 5 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 2 ? THR A 3 ? LEU A 2 THR A 3 A 2 MET A 46 ? LEU A 47 ? MET A 46 LEU A 47 B 1 GLN A 25 ? LYS A 28 ? GLN A 25 LYS A 28 B 2 ALA A 19 ? TYR A 22 ? ALA A 19 TYR A 22 B 3 ILE A 69 ? ARG A 70 ? ILE A 69 ARG A 70 C 1 ILE A 34 ? VAL A 37 ? ILE A 34 VAL A 37 C 2 VAL A 50 ? VAL A 56 ? VAL A 50 VAL A 56 C 3 LYS A 95 ? LEU A 105 ? LYS A 95 LEU A 105 C 4 LYS A 85 ? TRP A 92 ? LYS A 85 TRP A 92 C 5 VAL A 78 ? CYS A 81 ? VAL A 78 CYS A 81 D 1 LYS A 136 ? ASN A 138 ? LYS A 136 ASN A 138 D 2 GLY A 141 ? LYS A 144 ? GLY A 141 LYS A 144 D 3 THR A 147 ? VAL A 149 ? THR A 147 VAL A 149 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 2 ? N LEU A 2 O LEU A 47 ? O LEU A 47 B 1 2 O ILE A 27 ? O ILE A 27 N PHE A 20 ? N PHE A 20 B 2 3 N ALA A 19 ? N ALA A 19 O ARG A 70 ? O ARG A 70 C 1 2 N VAL A 35 ? N VAL A 35 O LEU A 53 ? O LEU A 53 C 2 3 N ILE A 54 ? N ILE A 54 O PHE A 102 ? O PHE A 102 C 3 4 O LEU A 99 ? O LEU A 99 N LEU A 88 ? N LEU A 88 C 4 5 O VAL A 87 ? O VAL A 87 N LYS A 79 ? N LYS A 79 D 1 2 N LYS A 136 ? N LYS A 136 O PHE A 143 ? O PHE A 143 D 2 3 N LYS A 144 ? N LYS A 144 O THR A 147 ? O THR A 147 # _atom_sites.entry_id 2M2V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 LEU 174 174 174 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-02 2 'Structure model' 1 1 2014-11-12 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 0.5 ? mM 'ILV-CH3-[U-13C; U-15N; U-2H]' 1 Mg-2 10 ? mM ? 1 dGTP-3 4 ? mM ? 1 DNA-4 0.6 ? mM '[U-100% 13C; U-100% 15N]' 1 Borate-5 50 ? mM ? 1 DTT-6 10 ? mM '[U-2H]' 1 'potassium chloride-7' 200 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M2V _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3030 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1356 _pdbx_nmr_constraints.NOE_long_range_total_count 431 _pdbx_nmr_constraints.NOE_medium_range_total_count 533 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 710 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 155 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 155 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ3 A LYS 152 ? ? OE2 A GLU 162 ? ? 1.56 2 1 O A LYS 131 ? ? H A ASN 134 ? ? 1.59 3 2 HE A ARG 168 ? ? OXT A LEU 174 ? ? 1.53 4 2 OE2 A GLU 21 ? ? HH21 A ARG 70 ? ? 1.58 5 3 HZ1 A LYS 85 ? ? OD1 A ASP 100 ? ? 1.58 6 3 O A LEU 88 ? ? H A LEU 99 ? ? 1.60 7 5 OE2 A GLU 43 ? ? HZ3 A LYS 171 ? ? 1.57 8 5 O A ILE 113 ? ? HG1 A THR 117 ? ? 1.58 9 7 OE2 A GLU 21 ? ? HH21 A ARG 70 ? ? 1.54 10 8 OE2 A GLU 158 ? ? HZ1 A LYS 161 ? ? 1.60 11 9 H A GLU 21 ? ? O A ASN 68 ? ? 1.60 12 9 HZ3 A LYS 59 ? ? OE1 A GLU 107 ? ? 1.60 13 10 OE2 A GLU 158 ? ? HZ2 A LYS 161 ? ? 1.59 14 10 OE2 A GLU 21 ? ? HH21 A ARG 70 ? ? 1.59 15 13 HZ3 A LYS 59 ? ? OE2 A GLU 107 ? ? 1.58 16 13 HH21 A ARG 41 ? ? OE2 A GLU 43 ? ? 1.58 17 13 O A LYS 131 ? ? H A ASN 134 ? ? 1.60 18 18 HZ3 A LYS 109 ? ? OE1 A GLU 156 ? ? 1.54 19 18 OE2 A GLU 158 ? ? HZ2 A LYS 161 ? ? 1.58 20 19 H A GLU 21 ? ? O A ASN 68 ? ? 1.58 21 19 O A LEU 88 ? ? H A LEU 99 ? ? 1.59 22 19 O A LYS 131 ? ? H A ASN 134 ? ? 1.59 23 19 HZ3 A LYS 85 ? ? OD2 A ASP 100 ? ? 1.60 24 20 HG A SER 121 ? ? O A LEU 174 ? ? 1.58 25 20 OE2 A GLU 21 ? ? HH11 A ARG 70 ? ? 1.59 26 20 HZ3 A LYS 109 ? ? OE1 A GLU 156 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 60 ? ? -122.47 -79.32 2 1 LEU A 61 ? ? -38.92 -21.98 3 1 ARG A 70 ? ? -177.97 -169.87 4 1 THR A 154 ? ? -153.52 8.61 5 1 ARG A 173 ? ? 69.57 132.57 6 2 LEU A 47 ? ? -102.81 -161.28 7 2 ASN A 48 ? ? -130.60 -49.40 8 2 LYS A 59 ? ? -94.47 34.63 9 2 LYS A 60 ? ? -143.38 -81.84 10 2 LEU A 61 ? ? -32.35 -38.95 11 2 ARG A 70 ? ? 177.36 -176.39 12 2 ARG A 125 ? ? -44.09 8.11 13 2 ILE A 126 ? ? -132.55 -41.16 14 2 THR A 154 ? ? -158.92 4.17 15 2 ARG A 173 ? ? 64.30 114.82 16 3 LYS A 60 ? ? -125.41 -76.82 17 3 LEU A 61 ? ? -35.80 -25.92 18 3 ARG A 70 ? ? 175.95 -171.73 19 3 ARG A 125 ? ? -46.10 -18.77 20 3 ARG A 173 ? ? -127.39 -149.49 21 4 TYR A 22 ? ? -162.34 96.69 22 4 LYS A 32 ? ? -74.15 35.95 23 4 ASN A 33 ? ? -153.71 -4.78 24 4 LYS A 60 ? ? -124.03 -78.35 25 4 LEU A 61 ? ? -37.96 -27.75 26 4 ARG A 70 ? ? 177.99 -179.16 27 4 ARG A 125 ? ? -49.24 -19.27 28 4 LYS A 131 ? ? -68.37 0.52 29 4 GLN A 139 ? ? -69.96 12.68 30 4 GLN A 146 ? ? 73.26 -4.22 31 4 ARG A 173 ? ? 69.08 137.63 32 5 LYS A 60 ? ? -123.76 -79.52 33 5 LEU A 61 ? ? -35.16 -26.93 34 5 ARG A 70 ? ? -178.28 -167.49 35 5 LEU A 74 ? ? -125.84 -162.30 36 5 CYS A 81 ? ? -117.63 70.88 37 5 ASN A 134 ? ? 77.51 36.66 38 5 GLN A 146 ? ? 74.54 -4.32 39 5 THR A 154 ? ? -150.56 0.87 40 5 PHE A 165 ? ? -121.34 -163.86 41 5 ARG A 173 ? ? 65.95 141.19 42 6 LYS A 60 ? ? -121.25 -76.53 43 6 LEU A 61 ? ? -38.47 -22.61 44 6 ARG A 70 ? ? -172.69 -174.64 45 6 THR A 154 ? ? -154.60 9.92 46 7 LYS A 60 ? ? -124.92 -73.34 47 7 LEU A 61 ? ? -39.05 -22.25 48 7 LEU A 74 ? ? -125.48 -154.07 49 7 THR A 154 ? ? -157.89 -6.79 50 7 ARG A 173 ? ? 65.40 149.78 51 8 ALA A 19 ? ? -174.17 -179.19 52 8 LYS A 60 ? ? -123.23 -80.08 53 8 LEU A 61 ? ? -33.98 -28.19 54 8 LEU A 74 ? ? -128.96 -157.82 55 8 ASN A 134 ? ? 76.12 40.86 56 8 LEU A 137 ? ? -34.53 127.87 57 8 THR A 154 ? ? -149.31 -5.36 58 8 ARG A 173 ? ? 69.83 142.97 59 9 LYS A 60 ? ? -136.54 -78.84 60 9 LEU A 61 ? ? -33.76 -34.63 61 9 ARG A 70 ? ? -179.46 -174.35 62 9 GLN A 139 ? ? -75.23 23.57 63 9 GLN A 146 ? ? 58.42 9.77 64 9 THR A 154 ? ? -145.60 -2.40 65 9 ARG A 173 ? ? 59.98 119.45 66 10 TYR A 22 ? ? -166.86 97.98 67 10 LYS A 32 ? ? -68.77 31.48 68 10 ASN A 33 ? ? -158.04 -1.50 69 10 LYS A 60 ? ? -124.12 -77.48 70 10 LEU A 61 ? ? -39.04 -24.24 71 10 PRO A 67 ? ? -46.92 -70.87 72 10 ASN A 134 ? ? 72.21 46.66 73 10 THR A 154 ? ? -147.97 -16.21 74 10 ARG A 173 ? ? -44.21 157.76 75 11 TYR A 22 ? ? -155.83 89.47 76 11 LYS A 32 ? ? -70.24 36.38 77 11 ASN A 33 ? ? -157.92 2.34 78 11 GLU A 43 ? ? 63.50 60.74 79 11 GLU A 44 ? ? -101.49 -153.69 80 11 MET A 46 ? ? -163.19 108.96 81 11 LYS A 60 ? ? -118.70 -74.30 82 11 LEU A 74 ? ? -128.64 -156.65 83 11 THR A 154 ? ? -161.08 2.54 84 11 ARG A 173 ? ? 63.50 141.14 85 12 GLU A 43 ? ? 60.35 67.03 86 12 GLU A 44 ? ? -108.38 -149.82 87 12 LYS A 45 ? ? -150.79 -24.26 88 12 LYS A 60 ? ? -129.32 -81.63 89 12 LEU A 61 ? ? -32.18 -32.31 90 12 ARG A 70 ? ? -175.00 -179.50 91 12 ASN A 134 ? ? 72.36 42.59 92 12 GLN A 139 ? ? -78.17 30.63 93 12 THR A 154 ? ? -142.44 -6.99 94 12 ARG A 173 ? ? -41.77 152.84 95 13 TYR A 22 ? ? -163.73 97.02 96 13 LYS A 60 ? ? -122.64 -74.82 97 13 LEU A 61 ? ? -38.85 -23.88 98 13 ARG A 70 ? ? -176.48 -175.58 99 13 THR A 154 ? ? -153.47 -5.83 100 13 ARG A 173 ? ? 65.37 131.26 101 14 LEU A 61 ? ? -37.07 -31.74 102 14 LEU A 74 ? ? -101.12 -164.95 103 14 PHE A 114 ? ? -66.44 7.99 104 14 LYS A 132 ? ? -47.69 -19.12 105 14 ASN A 134 ? ? 78.13 54.01 106 14 ARG A 173 ? ? 91.23 148.82 107 15 ASN A 23 ? ? 58.76 16.59 108 15 LYS A 32 ? ? -72.50 34.68 109 15 ASN A 33 ? ? -153.64 -9.12 110 15 LYS A 60 ? ? -117.15 -82.24 111 15 LEU A 61 ? ? -36.37 -24.73 112 15 LEU A 74 ? ? -128.20 -162.72 113 15 PHE A 114 ? ? -67.58 18.17 114 15 HIS A 115 ? ? -135.29 -39.89 115 15 ARG A 125 ? ? -49.78 -16.35 116 15 ASN A 134 ? ? 62.97 60.93 117 15 THR A 154 ? ? -151.48 0.47 118 15 ARG A 173 ? ? 49.40 80.49 119 16 TYR A 22 ? ? -164.42 95.81 120 16 LYS A 32 ? ? -75.59 39.47 121 16 ASN A 33 ? ? -154.07 -3.04 122 16 LYS A 60 ? ? -119.65 -77.24 123 16 LEU A 61 ? ? -38.89 -23.20 124 16 LEU A 74 ? ? -122.13 -155.87 125 16 ASN A 134 ? ? 63.74 64.75 126 16 ASN A 145 ? ? 47.89 74.28 127 16 THR A 154 ? ? -143.08 -7.53 128 16 ARG A 173 ? ? 59.67 86.45 129 17 TYR A 22 ? ? -163.72 94.79 130 17 LYS A 32 ? ? -68.82 31.02 131 17 ASN A 33 ? ? -157.51 1.36 132 17 LYS A 60 ? ? -128.81 -74.33 133 17 LEU A 61 ? ? -36.49 -27.26 134 17 LEU A 74 ? ? -136.44 -155.15 135 17 GLU A 83 ? ? -91.10 -60.71 136 17 THR A 154 ? ? -144.38 -7.11 137 17 ARG A 173 ? ? 67.89 145.25 138 18 LYS A 32 ? ? -69.09 33.86 139 18 ASN A 33 ? ? -155.87 0.74 140 18 LYS A 60 ? ? -126.21 -79.65 141 18 LEU A 61 ? ? -33.66 -31.12 142 18 LEU A 74 ? ? -133.92 -158.03 143 18 LYS A 79 ? ? -125.12 -168.82 144 18 GLU A 83 ? ? -99.99 -62.41 145 18 LEU A 137 ? ? -34.51 125.08 146 18 THR A 154 ? ? -141.20 -8.91 147 18 ARG A 173 ? ? 71.84 148.17 148 19 TYR A 22 ? ? -164.06 99.55 149 19 LYS A 32 ? ? -72.30 38.30 150 19 ASN A 33 ? ? -155.63 3.89 151 19 GLU A 43 ? ? 60.47 74.14 152 19 GLU A 44 ? ? -101.32 -158.69 153 19 LYS A 60 ? ? -119.24 -76.44 154 19 LEU A 61 ? ? -37.82 -23.98 155 19 LYS A 79 ? ? -114.85 -165.12 156 19 THR A 154 ? ? -152.19 -6.99 157 19 ARG A 173 ? ? 69.04 154.80 158 20 LYS A 32 ? ? -77.72 24.80 159 20 ASN A 33 ? ? -152.36 18.62 160 20 VAL A 37 ? ? -100.33 -169.98 161 20 LEU A 61 ? ? -38.86 -32.73 162 20 LEU A 74 ? ? -125.23 -165.27 163 20 PHE A 114 ? ? -48.88 -12.82 164 20 ASN A 134 ? ? 66.94 62.68 165 20 LYS A 144 ? ? -107.61 76.68 166 20 ASN A 145 ? ? 54.72 72.05 167 20 GLN A 146 ? ? 71.25 -12.08 168 20 THR A 154 ? ? -141.10 -12.69 #