data_2M64 # _entry.id 2M64 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2M64 pdb_00002m64 10.2210/pdb2m64/pdb RCSB RCSB103256 ? ? BMRB 19107 ? ? WWPDB D_1000103256 ? ? # _pdbx_database_related.db_id 19107 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2M64 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-03-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Goebl, C.' 1 'Focke, M.' 2 'Schrank, E.' 3 'Madl, T.' 4 'Kosol, S.' 5 'Madritsch, C.' 6 'Flicker, S.' 7 'Valenta, R.' 8 'Zangger, K.' 9 'Tjandra, N.' 10 # _citation.id primary _citation.title 'Flexible IgE epitope-containing domains of Phl p 5 cause high allergenic activity.' _citation.journal_abbrev 'J. Allergy Clin. Immunol.' _citation.journal_volume 140 _citation.page_first 1187 _citation.page_last 1191 _citation.year 2017 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1097-6825 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 28532654 _citation.pdbx_database_id_DOI 10.1016/j.jaci.2017.05.005 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gobl, C.' 1 ? primary 'Focke-Tejkl, M.' 2 ? primary 'Najafi, N.' 3 ? primary 'Schrank, E.' 4 ? primary 'Madl, T.' 5 ? primary 'Kosol, S.' 6 ? primary 'Madritsch, C.' 7 ? primary 'Dorofeeva, Y.' 8 ? primary 'Flicker, S.' 9 ? primary 'Thalhamer, J.' 10 ? primary 'Valenta, R.' 11 ? primary 'Zangger, K.' 12 ? primary 'Tjandra, N.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Phlp5 _entity.formula_weight 23770.955 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 55-285' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYK LAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFT VFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA ; _entity_poly.pdbx_seq_one_letter_code_can ;PAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYK LAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFT VFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ALA n 1 3 GLY n 1 4 LYS n 1 5 ALA n 1 6 THR n 1 7 THR n 1 8 GLU n 1 9 GLU n 1 10 GLN n 1 11 LYS n 1 12 LEU n 1 13 ILE n 1 14 GLU n 1 15 LYS n 1 16 ILE n 1 17 ASN n 1 18 ALA n 1 19 GLY n 1 20 PHE n 1 21 LYS n 1 22 ALA n 1 23 ALA n 1 24 LEU n 1 25 ALA n 1 26 ALA n 1 27 ALA n 1 28 ALA n 1 29 GLY n 1 30 VAL n 1 31 GLN n 1 32 PRO n 1 33 ALA n 1 34 ASP n 1 35 LYS n 1 36 TYR n 1 37 ARG n 1 38 THR n 1 39 PHE n 1 40 VAL n 1 41 ALA n 1 42 THR n 1 43 PHE n 1 44 GLY n 1 45 ALA n 1 46 ALA n 1 47 SER n 1 48 ASN n 1 49 LYS n 1 50 ALA n 1 51 PHE n 1 52 ALA n 1 53 GLU n 1 54 GLY n 1 55 LEU n 1 56 SER n 1 57 GLY n 1 58 GLU n 1 59 PRO n 1 60 LYS n 1 61 GLY n 1 62 ALA n 1 63 ALA n 1 64 GLU n 1 65 SER n 1 66 SER n 1 67 SER n 1 68 LYS n 1 69 ALA n 1 70 ALA n 1 71 LEU n 1 72 THR n 1 73 SER n 1 74 LYS n 1 75 LEU n 1 76 ASP n 1 77 ALA n 1 78 ALA n 1 79 TYR n 1 80 LYS n 1 81 LEU n 1 82 ALA n 1 83 TYR n 1 84 LYS n 1 85 THR n 1 86 ALA n 1 87 GLU n 1 88 GLY n 1 89 ALA n 1 90 THR n 1 91 PRO n 1 92 GLU n 1 93 ALA n 1 94 LYS n 1 95 TYR n 1 96 ASP n 1 97 ALA n 1 98 TYR n 1 99 VAL n 1 100 ALA n 1 101 THR n 1 102 LEU n 1 103 SER n 1 104 GLU n 1 105 ALA n 1 106 LEU n 1 107 ARG n 1 108 ILE n 1 109 ILE n 1 110 ALA n 1 111 GLY n 1 112 THR n 1 113 LEU n 1 114 GLU n 1 115 VAL n 1 116 HIS n 1 117 ALA n 1 118 VAL n 1 119 LYS n 1 120 PRO n 1 121 ALA n 1 122 ALA n 1 123 GLU n 1 124 GLU n 1 125 VAL n 1 126 LYS n 1 127 VAL n 1 128 ILE n 1 129 PRO n 1 130 ALA n 1 131 GLY n 1 132 GLU n 1 133 LEU n 1 134 GLN n 1 135 VAL n 1 136 ILE n 1 137 GLU n 1 138 LYS n 1 139 VAL n 1 140 ASP n 1 141 ALA n 1 142 ALA n 1 143 PHE n 1 144 LYS n 1 145 VAL n 1 146 ALA n 1 147 ALA n 1 148 THR n 1 149 ALA n 1 150 ALA n 1 151 ASN n 1 152 ALA n 1 153 ALA n 1 154 PRO n 1 155 ALA n 1 156 ASN n 1 157 ASP n 1 158 LYS n 1 159 PHE n 1 160 THR n 1 161 VAL n 1 162 PHE n 1 163 GLU n 1 164 ALA n 1 165 ALA n 1 166 PHE n 1 167 ASN n 1 168 ASP n 1 169 ALA n 1 170 ILE n 1 171 LYS n 1 172 ALA n 1 173 SER n 1 174 THR n 1 175 GLY n 1 176 GLY n 1 177 ALA n 1 178 TYR n 1 179 GLU n 1 180 SER n 1 181 TYR n 1 182 LYS n 1 183 PHE n 1 184 ILE n 1 185 PRO n 1 186 ALA n 1 187 LEU n 1 188 GLU n 1 189 ALA n 1 190 ALA n 1 191 VAL n 1 192 LYS n 1 193 GLN n 1 194 ALA n 1 195 TYR n 1 196 ALA n 1 197 ALA n 1 198 THR n 1 199 VAL n 1 200 ALA n 1 201 THR n 1 202 ALA n 1 203 PRO n 1 204 GLU n 1 205 VAL n 1 206 LYS n 1 207 TYR n 1 208 THR n 1 209 VAL n 1 210 PHE n 1 211 GLU n 1 212 THR n 1 213 ALA n 1 214 LEU n 1 215 LYS n 1 216 LYS n 1 217 ALA n 1 218 ILE n 1 219 THR n 1 220 ALA n 1 221 MET n 1 222 SER n 1 223 GLU n 1 224 ALA n 1 225 GLN n 1 226 LYS n 1 227 ALA n 1 228 ALA n 1 229 LYS n 1 230 PRO n 1 231 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name timothy _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Phleum pratense' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 15957 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Bl21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pet17B _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q40960_PHLPR _struct_ref.pdbx_db_accession Q40960 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYK LAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFT VFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA ; _struct_ref.pdbx_align_begin 55 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2M64 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 231 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q40960 _struct_ref_seq.db_align_beg 55 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 285 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 55 _struct_ref_seq.pdbx_auth_seq_align_end 285 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 3 '2D 1H-15N HSQC' 1 2 3 '3D HNCO' 1 3 3 '3D HNCACB' 1 4 3 '3D HBHA(CO)NH' 1 5 1 '4D HCCH NOESY' 1 6 3 '4D HCNH NOESY' 1 7 1 '3D HNCO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 297 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ? 1 '93% H2O/7% D2O' ? 2 '93% H2O/7% D2O' ? 3 '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker DMX 1 'Bruker DMX' 600 Bruker DMX 2 'Bruker DMX' 900 Bruker DMX 3 'Bruker DMX' # _pdbx_nmr_refine.entry_id 2M64 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2M64 _pdbx_nmr_details.text 'The structure was determined using a combination of NOE and residual dipolar coupling data.' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2M64 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2M64 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.authors ? _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name 'X-PLOR NIH' _pdbx_nmr_software.ordinal 1 _pdbx_nmr_software.version ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2M64 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2M64 _struct.title '1H, 13C and 15N Chemical Shift Assignments for Phl p 5a' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2M64 _struct_keywords.pdbx_keywords 'PLANT PROTEIN' _struct_keywords.text 'PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 7 ? ILE A 13 ? THR A 61 ILE A 67 1 ? 7 HELX_P HELX_P2 2 LYS A 15 ? ALA A 28 ? LYS A 69 ALA A 82 1 ? 14 HELX_P HELX_P3 3 ASP A 34 ? GLY A 54 ? ASP A 88 GLY A 108 1 ? 21 HELX_P HELX_P4 4 SER A 65 ? ALA A 89 ? SER A 119 ALA A 143 1 ? 25 HELX_P HELX_P5 5 ALA A 93 ? LEU A 113 ? ALA A 147 LEU A 167 1 ? 21 HELX_P HELX_P6 6 VAL A 135 ? ALA A 152 ? VAL A 189 ALA A 206 1 ? 18 HELX_P HELX_P7 7 ASP A 157 ? THR A 174 ? ASP A 211 THR A 228 1 ? 18 HELX_P HELX_P8 8 ALA A 186 ? THR A 198 ? ALA A 240 THR A 252 1 ? 13 HELX_P HELX_P9 9 VAL A 205 ? ALA A 227 ? VAL A 259 ALA A 281 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2M64 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 55 55 PRO PRO A . n A 1 2 ALA 2 56 56 ALA ALA A . n A 1 3 GLY 3 57 57 GLY GLY A . n A 1 4 LYS 4 58 58 LYS LYS A . n A 1 5 ALA 5 59 59 ALA ALA A . n A 1 6 THR 6 60 60 THR THR A . n A 1 7 THR 7 61 61 THR THR A . n A 1 8 GLU 8 62 62 GLU GLU A . n A 1 9 GLU 9 63 63 GLU GLU A . n A 1 10 GLN 10 64 64 GLN GLN A . n A 1 11 LYS 11 65 65 LYS LYS A . n A 1 12 LEU 12 66 66 LEU LEU A . n A 1 13 ILE 13 67 67 ILE ILE A . n A 1 14 GLU 14 68 68 GLU GLU A . n A 1 15 LYS 15 69 69 LYS LYS A . n A 1 16 ILE 16 70 70 ILE ILE A . n A 1 17 ASN 17 71 71 ASN ASN A . n A 1 18 ALA 18 72 72 ALA ALA A . n A 1 19 GLY 19 73 73 GLY GLY A . n A 1 20 PHE 20 74 74 PHE PHE A . n A 1 21 LYS 21 75 75 LYS LYS A . n A 1 22 ALA 22 76 76 ALA ALA A . n A 1 23 ALA 23 77 77 ALA ALA A . n A 1 24 LEU 24 78 78 LEU LEU A . n A 1 25 ALA 25 79 79 ALA ALA A . n A 1 26 ALA 26 80 80 ALA ALA A . n A 1 27 ALA 27 81 81 ALA ALA A . n A 1 28 ALA 28 82 82 ALA ALA A . n A 1 29 GLY 29 83 83 GLY GLY A . n A 1 30 VAL 30 84 84 VAL VAL A . n A 1 31 GLN 31 85 85 GLN GLN A . n A 1 32 PRO 32 86 86 PRO PRO A . n A 1 33 ALA 33 87 87 ALA ALA A . n A 1 34 ASP 34 88 88 ASP ASP A . n A 1 35 LYS 35 89 89 LYS LYS A . n A 1 36 TYR 36 90 90 TYR TYR A . n A 1 37 ARG 37 91 91 ARG ARG A . n A 1 38 THR 38 92 92 THR THR A . n A 1 39 PHE 39 93 93 PHE PHE A . n A 1 40 VAL 40 94 94 VAL VAL A . n A 1 41 ALA 41 95 95 ALA ALA A . n A 1 42 THR 42 96 96 THR THR A . n A 1 43 PHE 43 97 97 PHE PHE A . n A 1 44 GLY 44 98 98 GLY GLY A . n A 1 45 ALA 45 99 99 ALA ALA A . n A 1 46 ALA 46 100 100 ALA ALA A . n A 1 47 SER 47 101 101 SER SER A . n A 1 48 ASN 48 102 102 ASN ASN A . n A 1 49 LYS 49 103 103 LYS LYS A . n A 1 50 ALA 50 104 104 ALA ALA A . n A 1 51 PHE 51 105 105 PHE PHE A . n A 1 52 ALA 52 106 106 ALA ALA A . n A 1 53 GLU 53 107 107 GLU GLU A . n A 1 54 GLY 54 108 108 GLY GLY A . n A 1 55 LEU 55 109 109 LEU LEU A . n A 1 56 SER 56 110 110 SER SER A . n A 1 57 GLY 57 111 111 GLY GLY A . n A 1 58 GLU 58 112 112 GLU GLU A . n A 1 59 PRO 59 113 113 PRO PRO A . n A 1 60 LYS 60 114 114 LYS LYS A . n A 1 61 GLY 61 115 115 GLY GLY A . n A 1 62 ALA 62 116 116 ALA ALA A . n A 1 63 ALA 63 117 117 ALA ALA A . n A 1 64 GLU 64 118 118 GLU GLU A . n A 1 65 SER 65 119 119 SER SER A . n A 1 66 SER 66 120 120 SER SER A . n A 1 67 SER 67 121 121 SER SER A . n A 1 68 LYS 68 122 122 LYS LYS A . n A 1 69 ALA 69 123 123 ALA ALA A . n A 1 70 ALA 70 124 124 ALA ALA A . n A 1 71 LEU 71 125 125 LEU LEU A . n A 1 72 THR 72 126 126 THR THR A . n A 1 73 SER 73 127 127 SER SER A . n A 1 74 LYS 74 128 128 LYS LYS A . n A 1 75 LEU 75 129 129 LEU LEU A . n A 1 76 ASP 76 130 130 ASP ASP A . n A 1 77 ALA 77 131 131 ALA ALA A . n A 1 78 ALA 78 132 132 ALA ALA A . n A 1 79 TYR 79 133 133 TYR TYR A . n A 1 80 LYS 80 134 134 LYS LYS A . n A 1 81 LEU 81 135 135 LEU LEU A . n A 1 82 ALA 82 136 136 ALA ALA A . n A 1 83 TYR 83 137 137 TYR TYR A . n A 1 84 LYS 84 138 138 LYS LYS A . n A 1 85 THR 85 139 139 THR THR A . n A 1 86 ALA 86 140 140 ALA ALA A . n A 1 87 GLU 87 141 141 GLU GLU A . n A 1 88 GLY 88 142 142 GLY GLY A . n A 1 89 ALA 89 143 143 ALA ALA A . n A 1 90 THR 90 144 144 THR THR A . n A 1 91 PRO 91 145 145 PRO PRO A . n A 1 92 GLU 92 146 146 GLU GLU A . n A 1 93 ALA 93 147 147 ALA ALA A . n A 1 94 LYS 94 148 148 LYS LYS A . n A 1 95 TYR 95 149 149 TYR TYR A . n A 1 96 ASP 96 150 150 ASP ASP A . n A 1 97 ALA 97 151 151 ALA ALA A . n A 1 98 TYR 98 152 152 TYR TYR A . n A 1 99 VAL 99 153 153 VAL VAL A . n A 1 100 ALA 100 154 154 ALA ALA A . n A 1 101 THR 101 155 155 THR THR A . n A 1 102 LEU 102 156 156 LEU LEU A . n A 1 103 SER 103 157 157 SER SER A . n A 1 104 GLU 104 158 158 GLU GLU A . n A 1 105 ALA 105 159 159 ALA ALA A . n A 1 106 LEU 106 160 160 LEU LEU A . n A 1 107 ARG 107 161 161 ARG ARG A . n A 1 108 ILE 108 162 162 ILE ILE A . n A 1 109 ILE 109 163 163 ILE ILE A . n A 1 110 ALA 110 164 164 ALA ALA A . n A 1 111 GLY 111 165 165 GLY GLY A . n A 1 112 THR 112 166 166 THR THR A . n A 1 113 LEU 113 167 167 LEU LEU A . n A 1 114 GLU 114 168 168 GLU GLU A . n A 1 115 VAL 115 169 169 VAL VAL A . n A 1 116 HIS 116 170 170 HIS HIS A . n A 1 117 ALA 117 171 171 ALA ALA A . n A 1 118 VAL 118 172 172 VAL VAL A . n A 1 119 LYS 119 173 173 LYS LYS A . n A 1 120 PRO 120 174 174 PRO PRO A . n A 1 121 ALA 121 175 175 ALA ALA A . n A 1 122 ALA 122 176 176 ALA ALA A . n A 1 123 GLU 123 177 177 GLU GLU A . n A 1 124 GLU 124 178 178 GLU GLU A . n A 1 125 VAL 125 179 179 VAL VAL A . n A 1 126 LYS 126 180 180 LYS LYS A . n A 1 127 VAL 127 181 181 VAL VAL A . n A 1 128 ILE 128 182 182 ILE ILE A . n A 1 129 PRO 129 183 183 PRO PRO A . n A 1 130 ALA 130 184 184 ALA ALA A . n A 1 131 GLY 131 185 185 GLY GLY A . n A 1 132 GLU 132 186 186 GLU GLU A . n A 1 133 LEU 133 187 187 LEU LEU A . n A 1 134 GLN 134 188 188 GLN GLN A . n A 1 135 VAL 135 189 189 VAL VAL A . n A 1 136 ILE 136 190 190 ILE ILE A . n A 1 137 GLU 137 191 191 GLU GLU A . n A 1 138 LYS 138 192 192 LYS LYS A . n A 1 139 VAL 139 193 193 VAL VAL A . n A 1 140 ASP 140 194 194 ASP ASP A . n A 1 141 ALA 141 195 195 ALA ALA A . n A 1 142 ALA 142 196 196 ALA ALA A . n A 1 143 PHE 143 197 197 PHE PHE A . n A 1 144 LYS 144 198 198 LYS LYS A . n A 1 145 VAL 145 199 199 VAL VAL A . n A 1 146 ALA 146 200 200 ALA ALA A . n A 1 147 ALA 147 201 201 ALA ALA A . n A 1 148 THR 148 202 202 THR THR A . n A 1 149 ALA 149 203 203 ALA ALA A . n A 1 150 ALA 150 204 204 ALA ALA A . n A 1 151 ASN 151 205 205 ASN ASN A . n A 1 152 ALA 152 206 206 ALA ALA A . n A 1 153 ALA 153 207 207 ALA ALA A . n A 1 154 PRO 154 208 208 PRO PRO A . n A 1 155 ALA 155 209 209 ALA ALA A . n A 1 156 ASN 156 210 210 ASN ASN A . n A 1 157 ASP 157 211 211 ASP ASP A . n A 1 158 LYS 158 212 212 LYS LYS A . n A 1 159 PHE 159 213 213 PHE PHE A . n A 1 160 THR 160 214 214 THR THR A . n A 1 161 VAL 161 215 215 VAL VAL A . n A 1 162 PHE 162 216 216 PHE PHE A . n A 1 163 GLU 163 217 217 GLU GLU A . n A 1 164 ALA 164 218 218 ALA ALA A . n A 1 165 ALA 165 219 219 ALA ALA A . n A 1 166 PHE 166 220 220 PHE PHE A . n A 1 167 ASN 167 221 221 ASN ASN A . n A 1 168 ASP 168 222 222 ASP ASP A . n A 1 169 ALA 169 223 223 ALA ALA A . n A 1 170 ILE 170 224 224 ILE ILE A . n A 1 171 LYS 171 225 225 LYS LYS A . n A 1 172 ALA 172 226 226 ALA ALA A . n A 1 173 SER 173 227 227 SER SER A . n A 1 174 THR 174 228 228 THR THR A . n A 1 175 GLY 175 229 229 GLY GLY A . n A 1 176 GLY 176 230 230 GLY GLY A . n A 1 177 ALA 177 231 231 ALA ALA A . n A 1 178 TYR 178 232 232 TYR TYR A . n A 1 179 GLU 179 233 233 GLU GLU A . n A 1 180 SER 180 234 234 SER SER A . n A 1 181 TYR 181 235 235 TYR TYR A . n A 1 182 LYS 182 236 236 LYS LYS A . n A 1 183 PHE 183 237 237 PHE PHE A . n A 1 184 ILE 184 238 238 ILE ILE A . n A 1 185 PRO 185 239 239 PRO PRO A . n A 1 186 ALA 186 240 240 ALA ALA A . n A 1 187 LEU 187 241 241 LEU LEU A . n A 1 188 GLU 188 242 242 GLU GLU A . n A 1 189 ALA 189 243 243 ALA ALA A . n A 1 190 ALA 190 244 244 ALA ALA A . n A 1 191 VAL 191 245 245 VAL VAL A . n A 1 192 LYS 192 246 246 LYS LYS A . n A 1 193 GLN 193 247 247 GLN GLN A . n A 1 194 ALA 194 248 248 ALA ALA A . n A 1 195 TYR 195 249 249 TYR TYR A . n A 1 196 ALA 196 250 250 ALA ALA A . n A 1 197 ALA 197 251 251 ALA ALA A . n A 1 198 THR 198 252 252 THR THR A . n A 1 199 VAL 199 253 253 VAL VAL A . n A 1 200 ALA 200 254 254 ALA ALA A . n A 1 201 THR 201 255 255 THR THR A . n A 1 202 ALA 202 256 256 ALA ALA A . n A 1 203 PRO 203 257 257 PRO PRO A . n A 1 204 GLU 204 258 258 GLU GLU A . n A 1 205 VAL 205 259 259 VAL VAL A . n A 1 206 LYS 206 260 260 LYS LYS A . n A 1 207 TYR 207 261 261 TYR TYR A . n A 1 208 THR 208 262 262 THR THR A . n A 1 209 VAL 209 263 263 VAL VAL A . n A 1 210 PHE 210 264 264 PHE PHE A . n A 1 211 GLU 211 265 265 GLU GLU A . n A 1 212 THR 212 266 266 THR THR A . n A 1 213 ALA 213 267 267 ALA ALA A . n A 1 214 LEU 214 268 268 LEU LEU A . n A 1 215 LYS 215 269 269 LYS LYS A . n A 1 216 LYS 216 270 270 LYS LYS A . n A 1 217 ALA 217 271 271 ALA ALA A . n A 1 218 ILE 218 272 272 ILE ILE A . n A 1 219 THR 219 273 273 THR THR A . n A 1 220 ALA 220 274 274 ALA ALA A . n A 1 221 MET 221 275 275 MET MET A . n A 1 222 SER 222 276 276 SER SER A . n A 1 223 GLU 223 277 277 GLU GLU A . n A 1 224 ALA 224 278 278 ALA ALA A . n A 1 225 GLN 225 279 279 GLN GLN A . n A 1 226 LYS 226 280 280 LYS LYS A . n A 1 227 ALA 227 281 281 ALA ALA A . n A 1 228 ALA 228 282 282 ALA ALA A . n A 1 229 LYS 229 283 283 LYS LYS A . n A 1 230 PRO 230 284 284 PRO PRO A . n A 1 231 ALA 231 285 285 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-03-26 2 'Structure model' 1 1 2018-02-28 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 15 3 'Structure model' '_pdbx_nmr_software.name' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2M64 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total ? _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 98 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 98 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 98 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A SER 110 ? ? HZ2 A LYS 122 ? ? 1.35 2 1 O A ASP 222 ? ? H A ALA 226 ? ? 1.45 3 1 O A LEU 156 ? ? H A LEU 160 ? ? 1.48 4 2 O A THR 262 ? ? H A THR 266 ? ? 1.56 5 3 O A THR 262 ? ? H A THR 266 ? ? 1.57 6 3 O A LEU 129 ? ? H A TYR 133 ? ? 1.58 7 4 O A LEU 156 ? ? H A LEU 160 ? ? 1.56 8 4 O A ASP 222 ? ? H A ALA 226 ? ? 1.57 9 4 O A GLU 62 ? ? H A LEU 66 ? ? 1.58 10 4 O A SER 157 ? ? H A ARG 161 ? ? 1.59 11 5 H A SER 110 ? ? HZ3 A LYS 122 ? ? 1.28 12 5 O A THR 262 ? ? H A THR 266 ? ? 1.56 13 7 O A THR 262 ? ? H A THR 266 ? ? 1.55 14 8 O A THR 262 ? ? H A THR 266 ? ? 1.59 15 9 O A LEU 156 ? ? H A LEU 160 ? ? 1.57 16 9 O A THR 92 ? ? H A THR 96 ? ? 1.58 17 9 O A SER 157 ? ? H A ARG 161 ? ? 1.58 18 9 O A GLU 62 ? ? H A LEU 66 ? ? 1.60 19 10 O A PRO 208 ? ? H A ASN 210 ? ? 1.57 20 10 O A THR 262 ? ? H A THR 266 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 88 ? ? 62.59 -5.80 2 1 GLU A 112 ? ? 62.29 66.67 3 1 GLU A 118 ? ? -130.14 -43.46 4 1 PRO A 145 ? ? -53.33 -0.24 5 1 ALA A 147 ? ? -178.74 39.16 6 1 HIS A 170 ? ? 61.81 62.56 7 1 VAL A 172 ? ? 39.43 95.28 8 1 GLU A 177 ? ? 73.80 84.84 9 1 GLU A 186 ? ? 67.30 -3.66 10 1 VAL A 189 ? ? -49.87 -15.25 11 1 ALA A 196 ? ? -49.45 -19.27 12 1 PRO A 208 ? ? -79.58 35.95 13 1 ASP A 211 ? ? 76.95 -7.77 14 1 THR A 228 ? ? -113.04 66.45 15 1 ALA A 231 ? ? 160.95 124.76 16 1 GLU A 233 ? ? -59.63 84.62 17 1 SER A 234 ? ? 135.88 146.95 18 1 TYR A 235 ? ? -65.31 82.94 19 1 LYS A 236 ? ? -138.27 -30.62 20 1 PHE A 237 ? ? -35.93 -31.70 21 1 ALA A 240 ? ? 98.64 -39.77 22 1 THR A 252 ? ? -69.81 51.74 23 1 VAL A 253 ? ? -142.64 -46.72 24 1 GLU A 258 ? ? -166.68 -40.97 25 2 LYS A 58 ? ? -175.00 -94.62 26 2 PRO A 86 ? ? -55.74 89.51 27 2 ALA A 87 ? ? -173.59 -45.07 28 2 LYS A 114 ? ? 55.39 90.54 29 2 ALA A 116 ? ? 55.65 77.14 30 2 PRO A 145 ? ? -54.66 4.71 31 2 ALA A 147 ? ? -161.80 37.93 32 2 GLU A 177 ? ? -158.47 -59.39 33 2 VAL A 179 ? ? -153.75 8.27 34 2 GLU A 186 ? ? 81.75 -33.46 35 2 ILE A 190 ? ? -46.71 -15.26 36 2 ALA A 206 ? ? -59.51 -1.09 37 2 PRO A 208 ? ? -47.73 167.00 38 2 ALA A 209 ? ? -39.40 -79.96 39 2 ASN A 210 ? ? -37.65 160.56 40 2 TYR A 232 ? ? 67.55 -40.86 41 2 GLU A 233 ? ? 25.37 29.70 42 2 SER A 234 ? ? 177.10 179.00 43 2 TYR A 235 ? ? -67.93 63.95 44 2 PHE A 237 ? ? -38.36 -28.46 45 2 ALA A 240 ? ? 94.64 -57.49 46 2 VAL A 253 ? ? 179.06 -56.50 47 2 THR A 255 ? ? -3.27 126.07 48 2 ALA A 256 ? ? -35.57 102.71 49 2 PRO A 257 ? ? -46.62 87.12 50 2 GLU A 258 ? ? -171.62 -39.73 51 3 ILE A 67 ? ? -47.66 -19.76 52 3 ASP A 88 ? ? 71.83 -35.52 53 3 SER A 110 ? ? 34.75 28.39 54 3 ALA A 117 ? ? 48.22 11.02 55 3 ALA A 147 ? ? 176.65 57.18 56 3 VAL A 172 ? ? 34.30 58.82 57 3 LYS A 173 ? ? 54.63 70.50 58 3 ALA A 176 ? ? -62.61 -140.11 59 3 GLU A 178 ? ? -175.03 108.69 60 3 ILE A 190 ? ? -47.82 -19.29 61 3 VAL A 199 ? ? -43.98 -19.21 62 3 PRO A 208 ? ? -66.06 25.42 63 3 THR A 228 ? ? -86.22 40.55 64 3 ALA A 231 ? ? 168.58 -65.77 65 3 ALA A 240 ? ? 134.76 -54.29 66 3 THR A 252 ? ? -73.32 41.82 67 3 ALA A 254 ? ? 93.49 70.31 68 3 ALA A 256 ? ? 28.06 77.10 69 3 PRO A 257 ? ? -45.80 82.85 70 3 GLU A 258 ? ? -173.97 -38.58 71 3 ALA A 281 ? ? 174.62 106.82 72 4 PRO A 86 ? ? -41.26 80.10 73 4 ALA A 87 ? ? 155.29 162.71 74 4 ASP A 88 ? ? 66.13 -6.19 75 4 LEU A 109 ? ? -108.60 43.82 76 4 PRO A 145 ? ? -48.35 168.96 77 4 GLU A 146 ? ? 69.27 -37.03 78 4 ALA A 171 ? ? 174.78 21.34 79 4 LYS A 173 ? ? -166.85 68.90 80 4 ALA A 175 ? ? -65.81 79.73 81 4 ALA A 176 ? ? -51.77 -175.81 82 4 GLU A 178 ? ? -91.81 55.58 83 4 ALA A 184 ? ? -40.25 160.69 84 4 GLU A 186 ? ? 78.35 -24.37 85 4 ALA A 209 ? ? 171.59 -89.96 86 4 ASP A 211 ? ? 71.78 -15.98 87 4 GLU A 233 ? ? -69.33 22.05 88 4 TYR A 235 ? ? -61.82 80.55 89 4 LYS A 236 ? ? -166.04 48.39 90 4 ALA A 240 ? ? 89.24 -46.10 91 4 GLU A 242 ? ? -36.12 -37.50 92 4 THR A 252 ? ? -49.53 -89.33 93 4 VAL A 253 ? ? 46.27 -85.64 94 4 ALA A 254 ? ? -127.14 -62.63 95 4 THR A 255 ? ? 56.91 160.57 96 4 ALA A 256 ? ? -46.56 108.20 97 4 PRO A 257 ? ? -50.02 82.16 98 4 GLU A 258 ? ? -173.50 -42.37 99 5 ILE A 67 ? ? -48.49 -19.87 100 5 ALA A 87 ? ? 53.88 -164.54 101 5 ASP A 88 ? ? 66.87 -30.44 102 5 PRO A 145 ? ? -48.65 165.07 103 5 GLU A 146 ? ? 81.36 7.42 104 5 ALA A 147 ? ? -172.52 -9.67 105 5 GLU A 168 ? ? -167.39 64.40 106 5 ALA A 176 ? ? 53.39 -109.41 107 5 GLU A 186 ? ? 84.87 -31.39 108 5 ALA A 206 ? ? -58.12 -6.26 109 5 PRO A 208 ? ? -71.72 -165.50 110 5 ALA A 209 ? ? -40.72 -82.22 111 5 ILE A 224 ? ? -92.37 -60.06 112 5 THR A 228 ? ? -114.54 57.03 113 5 ALA A 231 ? ? -176.03 -92.30 114 5 TYR A 232 ? ? -106.42 61.49 115 5 GLU A 233 ? ? -39.02 145.12 116 5 SER A 234 ? ? 47.25 -175.33 117 5 LYS A 236 ? ? -145.09 -33.84 118 5 ILE A 238 ? ? 54.75 100.49 119 5 PRO A 239 ? ? -47.93 -179.26 120 5 ALA A 240 ? ? 93.66 -48.37 121 5 THR A 252 ? ? -37.15 -80.11 122 5 VAL A 253 ? ? -29.12 -48.96 123 5 ALA A 256 ? ? -41.60 105.13 124 5 PRO A 257 ? ? -50.73 80.73 125 5 GLU A 258 ? ? -171.08 -39.61 126 5 ALA A 278 ? ? -49.39 -15.10 127 6 THR A 60 ? ? 59.61 121.01 128 6 GLN A 85 ? ? -152.00 -64.20 129 6 PRO A 86 ? ? -63.95 82.09 130 6 ALA A 87 ? ? 54.72 -155.46 131 6 ASP A 88 ? ? 64.36 -11.40 132 6 LEU A 109 ? ? 60.89 89.17 133 6 ALA A 117 ? ? 68.00 -134.92 134 6 GLU A 118 ? ? 49.19 26.59 135 6 SER A 119 ? ? -143.14 -8.89 136 6 ALA A 143 ? ? -133.82 -154.76 137 6 GLU A 146 ? ? 61.07 -2.61 138 6 ALA A 147 ? ? -155.66 30.99 139 6 ALA A 171 ? ? -160.99 -4.19 140 6 VAL A 181 ? ? 56.96 166.91 141 6 PRO A 208 ? ? -60.38 -154.69 142 6 ASP A 211 ? ? 75.02 -13.81 143 6 THR A 228 ? ? -95.07 50.04 144 6 ALA A 231 ? ? -168.73 -77.05 145 6 GLU A 233 ? ? -69.51 98.76 146 6 SER A 234 ? ? 104.34 -171.37 147 6 TYR A 235 ? ? -69.14 39.74 148 6 LYS A 236 ? ? -96.37 38.95 149 6 ILE A 238 ? ? 52.33 85.82 150 6 ALA A 240 ? ? 96.62 -18.77 151 6 ALA A 251 ? ? -97.13 -63.72 152 6 THR A 252 ? ? -34.42 -80.55 153 6 VAL A 253 ? ? -24.11 -50.51 154 6 ALA A 254 ? ? -113.57 77.80 155 6 VAL A 259 ? ? 43.75 16.37 156 6 ALA A 278 ? ? -43.49 -15.67 157 7 VAL A 84 ? ? -148.09 25.47 158 7 GLN A 85 ? ? 69.94 168.39 159 7 ALA A 87 ? ? 54.19 -172.40 160 7 ASP A 88 ? ? 77.76 -31.05 161 7 LEU A 109 ? ? -26.98 132.99 162 7 ALA A 117 ? ? 50.24 177.05 163 7 GLU A 118 ? ? 56.88 2.39 164 7 GLU A 146 ? ? 87.47 -22.37 165 7 ALA A 147 ? ? -145.04 -1.28 166 7 ALA A 171 ? ? -172.79 67.48 167 7 ALA A 176 ? ? 49.59 -158.81 168 7 GLU A 178 ? ? -64.56 89.47 169 7 GLU A 186 ? ? 73.70 -48.70 170 7 ALA A 196 ? ? -49.72 -19.25 171 7 ALA A 206 ? ? -59.06 -0.61 172 7 PRO A 208 ? ? -47.57 173.41 173 7 ASP A 211 ? ? -108.99 52.31 174 7 ALA A 223 ? ? -48.71 -19.76 175 7 THR A 228 ? ? -104.60 62.20 176 7 ALA A 231 ? ? -177.87 -39.35 177 7 LYS A 236 ? ? 178.81 -25.36 178 7 PRO A 239 ? ? -47.50 161.42 179 7 ALA A 240 ? ? 96.25 -40.09 180 7 THR A 252 ? ? -70.86 43.58 181 7 THR A 255 ? ? -0.22 124.24 182 7 ALA A 256 ? ? -35.82 105.89 183 7 PRO A 257 ? ? -48.01 82.72 184 7 GLU A 258 ? ? -166.24 -43.00 185 7 ALA A 278 ? ? -44.87 -15.99 186 8 THR A 60 ? ? -140.78 -141.45 187 8 PRO A 86 ? ? -59.54 -177.84 188 8 LEU A 109 ? ? -58.02 -78.68 189 8 SER A 110 ? ? 38.69 38.32 190 8 ALA A 117 ? ? -58.64 -9.13 191 8 PRO A 145 ? ? -70.80 48.30 192 8 ALA A 147 ? ? -174.17 22.77 193 8 ALA A 171 ? ? -164.57 42.55 194 8 GLU A 186 ? ? 86.43 -34.21 195 8 PRO A 208 ? ? -64.84 15.69 196 8 ALA A 209 ? ? 75.38 -9.52 197 8 ALA A 231 ? ? -62.81 -175.59 198 8 SER A 234 ? ? 49.42 178.78 199 8 TYR A 235 ? ? -81.03 -110.54 200 8 LYS A 236 ? ? 62.15 -25.88 201 8 ILE A 238 ? ? 58.81 94.88 202 8 ALA A 240 ? ? 109.50 -43.55 203 8 THR A 252 ? ? -33.08 -75.36 204 8 ALA A 254 ? ? -109.86 79.01 205 8 GLU A 258 ? ? -173.68 -26.60 206 9 LYS A 58 ? ? 61.20 67.12 207 9 THR A 60 ? ? -141.89 -157.48 208 9 PRO A 86 ? ? -40.70 87.58 209 9 ALA A 87 ? ? 156.15 162.29 210 9 ASP A 88 ? ? 64.27 -30.24 211 9 PRO A 145 ? ? -46.53 167.76 212 9 GLU A 146 ? ? 68.74 -38.37 213 9 ALA A 171 ? ? -156.02 54.74 214 9 LYS A 173 ? ? 39.35 56.74 215 9 GLU A 177 ? ? 62.31 102.33 216 9 VAL A 181 ? ? -44.12 161.91 217 9 PRO A 183 ? ? -80.23 -87.90 218 9 GLU A 186 ? ? 70.91 -31.03 219 9 VAL A 189 ? ? -49.66 -15.22 220 9 ALA A 203 ? ? -46.55 -19.06 221 9 ALA A 209 ? ? -31.21 -95.27 222 9 ASN A 210 ? ? 28.04 -104.98 223 9 THR A 228 ? ? -97.83 48.27 224 9 ALA A 231 ? ? -177.38 -73.20 225 9 TYR A 235 ? ? -57.18 -154.50 226 9 LYS A 236 ? ? 36.26 62.08 227 9 ALA A 240 ? ? 84.64 -45.90 228 9 GLU A 242 ? ? -39.31 -32.79 229 9 THR A 252 ? ? -108.78 -76.32 230 9 ALA A 254 ? ? 153.28 57.26 231 9 ALA A 256 ? ? -41.46 161.46 232 9 GLU A 258 ? ? 51.91 -177.40 233 9 VAL A 259 ? ? 38.95 16.10 234 10 ALA A 81 ? ? -69.86 5.28 235 10 PRO A 86 ? ? -41.57 91.53 236 10 ALA A 87 ? ? -172.78 -42.86 237 10 SER A 110 ? ? 77.68 -168.71 238 10 ALA A 116 ? ? 57.50 7.51 239 10 ALA A 117 ? ? -179.91 -29.54 240 10 ALA A 143 ? ? -128.94 -152.47 241 10 PRO A 145 ? ? -48.82 -5.45 242 10 ALA A 147 ? ? -174.02 62.57 243 10 GLU A 168 ? ? -116.14 51.46 244 10 ALA A 171 ? ? -171.67 18.12 245 10 LYS A 173 ? ? -162.37 68.26 246 10 GLU A 177 ? ? -47.50 171.04 247 10 GLU A 186 ? ? 86.97 -21.79 248 10 ILE A 190 ? ? -45.08 -16.71 249 10 ALA A 203 ? ? -49.75 -18.75 250 10 ALA A 206 ? ? -56.31 -5.96 251 10 ALA A 209 ? ? -65.22 37.74 252 10 ILE A 224 ? ? -91.47 -61.07 253 10 ALA A 231 ? ? -48.65 -178.63 254 10 TYR A 232 ? ? 66.47 -32.90 255 10 GLU A 233 ? ? 45.96 95.11 256 10 SER A 234 ? ? 65.53 -178.57 257 10 TYR A 235 ? ? -74.31 -160.60 258 10 ALA A 240 ? ? 92.93 -44.23 259 10 GLU A 242 ? ? -37.95 -34.42 260 10 THR A 252 ? ? -48.17 -89.81 261 10 VAL A 253 ? ? 41.21 -88.32 262 10 ALA A 254 ? ? -121.80 -67.51 263 10 THR A 255 ? ? 56.89 150.87 264 10 ALA A 256 ? ? -40.81 103.30 265 10 PRO A 257 ? ? -50.88 86.79 266 10 GLU A 258 ? ? -172.35 -38.40 #