data_2MA7 # _entry.id 2MA7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MA7 pdb_00002ma7 10.2210/pdb2ma7/pdb RCSB RCSB103403 ? ? BMRB 19331 ? ? WWPDB D_1000103403 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19331 BMRB unspecified . NESG-HR7992A TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MA7 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-06-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pulavarti, S.V.' 1 'Mills, J.L.' 2 'Wang, D.' 3 'Jigabm, E.' 4 'Hamilton, K.' 5 'Xiao, R.' 6 'Everett, J.K.' 7 'Acton, T.B.' 8 'Montelione, G.T.' 9 'Szyperski, T.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title 'Solution NMR Structure of Zinc finger protein Eos from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7992A' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pulavarti, S.V.' 1 ? primary 'Mills, J.L.' 2 ? primary 'Wang, D.' 3 ? primary 'Jigabm, E.' 4 ? primary 'Hamilton, K.' 5 ? primary 'Xiao, R.' 6 ? primary 'Everett, J.K.' 7 ? primary 'Acton, T.B.' 8 ? primary 'Montelione, G.T.' 9 ? primary 'Szyperski, T.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein Eos' 8274.718 1 ? ? 'UNP residues 155-213' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ikaros family zinc finger protein 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGHHHHHHSHMPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFK _entity_poly.pdbx_seq_one_letter_code_can MGHHHHHHSHMPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR7992A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 PRO n 1 13 ASN n 1 14 GLY n 1 15 LYS n 1 16 LEU n 1 17 LYS n 1 18 CYS n 1 19 ASP n 1 20 VAL n 1 21 CYS n 1 22 GLY n 1 23 MET n 1 24 VAL n 1 25 CYS n 1 26 ILE n 1 27 GLY n 1 28 PRO n 1 29 ASN n 1 30 VAL n 1 31 LEU n 1 32 MET n 1 33 VAL n 1 34 HIS n 1 35 LYS n 1 36 ARG n 1 37 SER n 1 38 HIS n 1 39 THR n 1 40 GLY n 1 41 GLU n 1 42 ARG n 1 43 PRO n 1 44 PHE n 1 45 HIS n 1 46 CYS n 1 47 ASN n 1 48 GLN n 1 49 CYS n 1 50 GLY n 1 51 ALA n 1 52 SER n 1 53 PHE n 1 54 THR n 1 55 GLN n 1 56 LYS n 1 57 GLY n 1 58 ASN n 1 59 LEU n 1 60 LEU n 1 61 ARG n 1 62 HIS n 1 63 ILE n 1 64 LYS n 1 65 LEU n 1 66 HIS n 1 67 SER n 1 68 GLY n 1 69 GLU n 1 70 LYS n 1 71 PRO n 1 72 PHE n 1 73 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'IKZF4, KIAA1782, ZNFN1A4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15_NESG _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IKZF4_HUMAN _struct_ref.pdbx_db_accession Q9H2S9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFK _struct_ref.pdbx_align_begin 155 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MA7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H2S9 _struct_ref_seq.db_align_beg 155 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 216 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MA7 MET A 1 ? UNP Q9H2S9 ? ? 'expression tag' 1 1 1 2MA7 GLY A 2 ? UNP Q9H2S9 ? ? 'expression tag' 2 2 1 2MA7 HIS A 3 ? UNP Q9H2S9 ? ? 'expression tag' 3 3 1 2MA7 HIS A 4 ? UNP Q9H2S9 ? ? 'expression tag' 4 4 1 2MA7 HIS A 5 ? UNP Q9H2S9 ? ? 'expression tag' 5 5 1 2MA7 HIS A 6 ? UNP Q9H2S9 ? ? 'expression tag' 6 6 1 2MA7 HIS A 7 ? UNP Q9H2S9 ? ? 'expression tag' 7 7 1 2MA7 HIS A 8 ? UNP Q9H2S9 ? ? 'expression tag' 8 8 1 2MA7 SER A 9 ? UNP Q9H2S9 ? ? 'expression tag' 9 9 1 2MA7 HIS A 10 ? UNP Q9H2S9 ? ? 'expression tag' 10 10 1 2MA7 MET A 11 ? UNP Q9H2S9 ? ? 'expression tag' 11 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '2D 1H-13C HSQC aromatic' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 2 '2D 1H-13C(CT) Aliphatic (28 ms)' 1 9 1 '2D 1H-13C(CT) Aliphatic' 1 10 1 '3D HBHA(CO)NH' 1 11 1 'gft43d_hcch_cosy aliphatic' 1 12 1 'gft43d_hcch_cosy aromatic' 1 13 1 '3D HCCH-TOCSY' 1 14 1 '2D 1H-15N HSQC (His longrange)' 1 15 1 '2D 1H-13C(CT)HSQC aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 75 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.0 mM [U-100% 13C; U-100% 15N] HR7992A.010, 5 mM DTT, 100 mM NaCl, 10 mM Tris-HCl pH 7.5, 0.02 % NaN3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [5% 13C; U-100% 15N] HR7992A.011, 10 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.02 mM NaN3, 5 mM DTT, 4 mM ZINC ION, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2MA7 _pdbx_nmr_refine.method 'simulated annealing, null' _pdbx_nmr_refine.details 'energy minimization, null' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MA7 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MA7 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'refinemen,structure solution,geometry optimization' CNS ? 1 'Guntert, Mumenthaler and Wuthrich' 'refinement,geometry optimization,structure solution' CYANA 3.0 2 'Huang, Tejero, Powers and Montelione' 'data analysis,refinement' AutoStructure 2.1 3 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis,chemical shift assignment' AutoAssign 2.1 4 'Bartels et al.' 'data analysis,peak picking,chemical shift assignment' XEASY ? 5 Varian collection VnmrJ ? 6 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 7 Guntert processing PROSA ? 8 'Bhattacharya, Montelione' 'structure validation' PSVS ? 9 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MA7 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MA7 _struct.title 'Solution NMR Structure of Zinc finger protein Eos from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7992A' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MA7 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, PSI-Biology, Protein Structure Initiative, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 29 ? THR A 39 ? ASN A 29 THR A 39 1 ? 11 HELX_P HELX_P2 2 GLN A 55 ? ILE A 63 ? GLN A 55 ILE A 63 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLN 48 O ? ? ? 1_555 B ZN . ZN ? ? A GLN 48 A ZN 101 1_555 ? ? ? ? ? ? ? 1.849 ? ? metalc2 metalc ? ? A CYS 49 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 49 A ZN 101 1_555 ? ? ? ? ? ? ? 1.925 ? ? metalc3 metalc ? ? A HIS 62 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 62 A ZN 101 1_555 ? ? ? ? ? ? ? 2.627 ? ? metalc4 metalc ? ? A HIS 66 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 66 A ZN 101 1_555 ? ? ? ? ? ? ? 1.841 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 44 ? CYS A 46 ? PHE A 44 CYS A 46 A 2 ALA A 51 ? PHE A 53 ? ALA A 51 PHE A 53 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 46 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 46 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ALA _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 51 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 51 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 46 ? CYS A 46 . ? 1_555 ? 2 AC1 5 GLN A 48 ? GLN A 48 . ? 1_555 ? 3 AC1 5 CYS A 49 ? CYS A 49 . ? 1_555 ? 4 AC1 5 HIS A 62 ? HIS A 62 . ? 1_555 ? 5 AC1 5 HIS A 66 ? HIS A 66 . ? 1_555 ? # _atom_sites.entry_id 2MA7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LYS 73 73 73 LYS LYS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 101 _pdbx_nonpoly_scheme.auth_seq_num 74 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLN 48 ? A GLN 48 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 91.9 ? 2 O ? A GLN 48 ? A GLN 48 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 178.0 ? 3 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 87.6 ? 4 O ? A GLN 48 ? A GLN 48 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 100.5 ? 5 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 112.5 ? 6 NE2 ? A HIS 62 ? A HIS 62 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 78.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-09-04 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_struct_conn_angle 5 2 'Structure model' struct_conn 6 2 'Structure model' struct_ref_seq_dif 7 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.value' 16 2 'Structure model' '_struct_conn.pdbx_dist_value' 17 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 2 'Structure model' '_struct_ref_seq_dif.details' 23 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HR7992A.010-1 1.0 ? mM '[U-100% 13C; U-100% 15N]' 1 DTT-2 5 ? mM ? 1 NaCl-3 100 ? mM ? 1 'Tris-HCl pH 7.5-4' 10 ? mM ? 1 NaN3-5 0.02 ? % ? 1 HR7992A.011-6 1 ? mM '[5% 13C; U-100% 15N]' 2 'Tris-HCl pH 7.5-7' 10 ? mM ? 2 NaCl-8 100 ? mM ? 2 NaN3-9 0.02 ? mM ? 2 DTT-10 5 ? mM ? 2 'ZINC ION-11' 4 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MA7 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 369 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 94 _pdbx_nmr_constraints.NOE_long_range_total_count 38 _pdbx_nmr_constraints.NOE_medium_range_total_count 102 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 135 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 23 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 23 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 7 ? ? -171.25 93.04 2 1 CYS A 18 ? ? -145.78 27.11 3 1 GLU A 41 ? ? -150.12 -42.20 4 1 GLN A 48 ? ? -110.49 73.47 5 1 CYS A 49 ? ? 173.67 -44.90 6 1 LYS A 70 ? ? 72.36 131.73 7 2 HIS A 7 ? ? -163.98 72.03 8 2 CYS A 46 ? ? -69.89 92.69 9 2 GLN A 48 ? ? -172.59 -43.07 10 2 HIS A 66 ? ? -98.31 31.62 11 2 SER A 67 ? ? 72.66 -171.29 12 2 PHE A 72 ? ? -153.79 -54.90 13 3 VAL A 24 ? ? 58.01 88.57 14 3 ASN A 29 ? ? -88.34 30.09 15 3 PHE A 44 ? ? -100.11 60.31 16 3 ASN A 47 ? ? -43.22 -72.11 17 3 GLU A 69 ? ? 70.11 139.30 18 4 HIS A 7 ? ? -103.53 -164.27 19 4 PRO A 43 ? ? -64.23 92.80 20 4 ASN A 47 ? ? -179.09 -173.29 21 4 LYS A 70 ? ? 68.76 173.63 22 5 HIS A 4 ? ? 60.51 88.38 23 5 LEU A 16 ? ? -172.69 143.46 24 5 CYS A 18 ? ? -166.65 91.67 25 5 VAL A 24 ? ? 61.80 80.61 26 5 CYS A 25 ? ? -169.54 79.50 27 5 GLU A 41 ? ? 57.22 78.09 28 5 ASN A 47 ? ? -178.00 -60.19 29 5 GLN A 48 ? ? -147.62 -23.48 30 5 GLU A 69 ? ? 58.61 83.47 31 6 LYS A 17 ? ? -166.65 116.52 32 6 CYS A 21 ? ? 71.06 -66.25 33 6 VAL A 24 ? ? 55.52 84.77 34 6 PRO A 43 ? ? -61.55 91.68 35 6 PHE A 44 ? ? -66.43 87.82 36 6 ASN A 47 ? ? -56.36 -75.88 37 6 SER A 67 ? ? 71.78 141.03 38 6 PHE A 72 ? ? 63.14 72.68 39 7 HIS A 8 ? ? -136.05 -31.08 40 7 SER A 9 ? ? 58.49 -98.29 41 7 HIS A 10 ? ? 178.95 43.87 42 7 PRO A 43 ? ? -68.99 4.72 43 7 GLN A 48 ? ? -178.72 -38.91 44 7 GLU A 69 ? ? 67.47 108.64 45 8 HIS A 6 ? ? 67.59 84.61 46 8 CYS A 25 ? ? -161.14 70.99 47 8 ASN A 29 ? ? -84.97 36.65 48 8 PHE A 53 ? ? -114.13 -163.06 49 8 THR A 54 ? ? -152.03 -34.90 50 8 PRO A 71 ? ? -55.27 98.98 51 9 PRO A 12 ? ? -65.12 82.53 52 9 GLU A 41 ? ? 61.21 -156.13 53 9 CYS A 46 ? ? -62.04 -80.61 54 9 ASN A 47 ? ? -176.22 -73.03 55 10 HIS A 4 ? ? -115.40 -164.13 56 10 HIS A 8 ? ? 60.71 91.54 57 10 THR A 39 ? ? 68.45 144.00 58 10 CYS A 46 ? ? -62.73 98.96 59 10 GLN A 48 ? ? 173.14 -41.60 60 10 SER A 67 ? ? 59.68 93.35 61 11 HIS A 4 ? ? -145.99 -62.70 62 11 HIS A 5 ? ? 60.23 95.14 63 11 ASN A 29 ? ? -84.09 39.95 64 11 CYS A 49 ? ? -136.99 -35.39 65 11 SER A 67 ? ? 61.21 83.82 66 11 PRO A 71 ? ? -60.74 91.70 67 12 MET A 11 ? ? -161.96 98.08 68 12 LYS A 17 ? ? -165.40 35.60 69 12 CYS A 18 ? ? -58.07 108.36 70 12 ASN A 29 ? ? -99.89 34.45 71 12 ASN A 47 ? ? 78.35 -60.62 72 12 THR A 54 ? ? -141.35 -6.71 73 13 HIS A 3 ? ? 59.28 101.14 74 13 VAL A 24 ? ? 63.43 111.20 75 13 CYS A 49 ? ? -178.89 -33.10 76 14 HIS A 3 ? ? 59.49 84.74 77 14 HIS A 38 ? ? -94.46 -94.26 78 14 CYS A 49 ? ? -124.11 -50.91 79 14 PRO A 71 ? ? -67.98 85.70 80 15 LEU A 16 ? ? 179.34 160.96 81 15 VAL A 24 ? ? 69.72 79.40 82 15 ASN A 29 ? ? -88.21 43.58 83 15 CYS A 46 ? ? -74.74 -94.11 84 15 ASN A 47 ? ? -151.81 -61.83 85 15 GLN A 48 ? ? -145.58 -13.74 86 15 PHE A 72 ? ? -87.18 -74.43 87 16 HIS A 7 ? ? -69.47 88.15 88 16 ASN A 13 ? ? -166.05 98.61 89 16 CYS A 49 ? ? 178.44 -31.81 90 16 PRO A 71 ? ? -42.89 96.84 91 17 HIS A 8 ? ? 59.08 87.22 92 17 HIS A 38 ? ? -73.53 -70.34 93 17 THR A 39 ? ? -176.80 -43.62 94 17 CYS A 46 ? ? -66.27 -95.91 95 17 ASN A 47 ? ? -153.16 -75.32 96 17 SER A 67 ? ? 68.99 174.45 97 17 LYS A 70 ? ? 70.23 132.18 98 18 PRO A 28 ? ? -56.25 172.11 99 18 CYS A 49 ? ? 155.87 -44.73 100 18 PHE A 72 ? ? 64.29 79.72 101 19 HIS A 6 ? ? -64.30 93.41 102 19 LEU A 16 ? ? -110.63 76.76 103 19 ASN A 29 ? ? -84.00 34.30 104 19 THR A 39 ? ? 67.00 75.05 105 19 PRO A 43 ? ? -67.96 97.96 106 19 PHE A 44 ? ? -66.71 79.40 107 19 ASN A 47 ? ? -175.95 -75.61 108 19 GLN A 48 ? ? -148.12 10.72 109 20 HIS A 3 ? ? 55.95 80.92 110 20 HIS A 5 ? ? 65.39 166.53 111 20 HIS A 7 ? ? 59.69 78.27 112 20 SER A 9 ? ? -121.36 -59.29 113 20 HIS A 10 ? ? 60.15 85.50 114 20 LYS A 15 ? ? -110.08 67.11 115 20 ASP A 19 ? ? 70.65 141.77 116 20 MET A 23 ? ? -166.36 -57.51 117 20 VAL A 24 ? ? 56.19 95.06 118 20 ILE A 26 ? ? 64.22 94.93 119 20 THR A 39 ? ? 52.67 -75.32 120 20 ASN A 47 ? ? -46.58 -73.62 121 20 CYS A 49 ? ? -172.08 -29.44 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #