data_2MBL # _entry.id 2MBL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MBL pdb_00002mbl 10.2210/pdb2mbl/pdb RCSB RCSB103446 ? ? BMRB 19404 ? ? WWPDB D_1000103446 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2mbm PDB . unspecified 19404 BMRB . unspecified 19405 BMRB . unspecified NESG-OR33 TargetTrack . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MBL _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-08-02 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Zanghellini, A.L.' 2 'Chan, K.' 3 'Xiao, R.' 4 'Janjua, H.' 5 'Kogan, S.' 6 'Maglaqui, M.' 7 'Ciccosanti, C.' 8 'Acton, T.B.' 9 'Kornhaber, G.' 10 'Everett, J.K.' 11 'Baker, D.' 12 'Montelione, G.T.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'Solution NMR Structure of De novo designed Top7 Fold Protein Top7m13, Northeast Structural Genomics Consortium (NESG) Target OR33' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Zanghellini, A.L.' 2 ? primary 'Chan, K.' 3 ? primary 'Xiao, R.' 4 ? primary 'Janjua, H.' 5 ? primary 'Kogan, S.' 6 ? primary 'Maglaqui, M.' 7 ? primary 'Ciccosanti, C.' 8 ? primary 'Acton, T.B.' 9 ? primary 'Kornhaber, G.' 10 ? primary 'Everett, J.K.' 11 ? primary 'Baker, D.' 12 ? primary 'Montelione, G.T.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Top7 Fold Protein Top7m13' _entity.formula_weight 13887.922 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSGKKVEVQVKITCNGKTYERTYQLYAVRDEELKEKLKKVLNERMDPIKKLGCKRVRISIRVKHSDAAEEKKEAKKFAAI LNKVFAELGYNDSNVTWDGDTVTVEGQLEGVDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSGKKVEVQVKITCNGKTYERTYQLYAVRDEELKEKLKKVLNERMDPIKKLGCKRVRISIRVKHSDAAEEKKEAKKFAAI LNKVFAELGYNDSNVTWDGDTVTVEGQLEGVDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-OR33 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 LYS n 1 5 LYS n 1 6 VAL n 1 7 GLU n 1 8 VAL n 1 9 GLN n 1 10 VAL n 1 11 LYS n 1 12 ILE n 1 13 THR n 1 14 CYS n 1 15 ASN n 1 16 GLY n 1 17 LYS n 1 18 THR n 1 19 TYR n 1 20 GLU n 1 21 ARG n 1 22 THR n 1 23 TYR n 1 24 GLN n 1 25 LEU n 1 26 TYR n 1 27 ALA n 1 28 VAL n 1 29 ARG n 1 30 ASP n 1 31 GLU n 1 32 GLU n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 LYS n 1 37 LEU n 1 38 LYS n 1 39 LYS n 1 40 VAL n 1 41 LEU n 1 42 ASN n 1 43 GLU n 1 44 ARG n 1 45 MET n 1 46 ASP n 1 47 PRO n 1 48 ILE n 1 49 LYS n 1 50 LYS n 1 51 LEU n 1 52 GLY n 1 53 CYS n 1 54 LYS n 1 55 ARG n 1 56 VAL n 1 57 ARG n 1 58 ILE n 1 59 SER n 1 60 ILE n 1 61 ARG n 1 62 VAL n 1 63 LYS n 1 64 HIS n 1 65 SER n 1 66 ASP n 1 67 ALA n 1 68 ALA n 1 69 GLU n 1 70 GLU n 1 71 LYS n 1 72 LYS n 1 73 GLU n 1 74 ALA n 1 75 LYS n 1 76 LYS n 1 77 PHE n 1 78 ALA n 1 79 ALA n 1 80 ILE n 1 81 LEU n 1 82 ASN n 1 83 LYS n 1 84 VAL n 1 85 PHE n 1 86 ALA n 1 87 GLU n 1 88 LEU n 1 89 GLY n 1 90 TYR n 1 91 ASN n 1 92 ASP n 1 93 SER n 1 94 ASN n 1 95 VAL n 1 96 THR n 1 97 TRP n 1 98 ASP n 1 99 GLY n 1 100 ASP n 1 101 THR n 1 102 VAL n 1 103 THR n 1 104 VAL n 1 105 GLU n 1 106 GLY n 1 107 GLN n 1 108 LEU n 1 109 GLU n 1 110 GLY n 1 111 VAL n 1 112 ASP n 1 113 LEU n 1 114 GLU n 1 115 HIS n 1 116 HIS n 1 117 HIS n 1 118 HIS n 1 119 HIS n 1 120 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'artificial gene' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET29b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2MBL _struct_ref.pdbx_db_accession 2MBL _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MBL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2MBL _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 120 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 1 '3D HCCH-TOCSY' 1 9 2 '2D 1H-13C HSQC aliphatic' 1 10 3 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.69 mM [U-100% 13C; U-100% 15N] OR33.017, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.69 mM [U-100% 13C; U-100% 15N] OR33.007, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.69 mM [U-100% 13C; U-100% 15N] OR33.007_rdc, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2MBL _pdbx_nmr_refine.method 'distance geometry, molecular dynamics, simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MBL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MBL _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 11 'Bartels et al.' 'data analysis,peak picking,chemical shift assignment' XEASY ? 12 'Bruker Biospin' collection TopSpin ? 13 Varian collection VnmrJ ? 14 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 15 Goddard 'data analysis' Sparky ? 16 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 17 'PALES (Zweckstetter, Bax)' 'geometry optimization' PALES ? 18 'Valafar, Prestegard' 'geometry optimization' REDCAT ? 19 'Bhattacharya, Montelione' 'structure validation' PSVS ? 20 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;The final structures were refined in explicit water using the program CNS with 2747 conformationally restricting constraints and addtional 67 RDC constraints. This final structure were further refined by using restained Rosetta (http://psvs-1_4-dev.nesg.org/consRosetta.html) with the same constraints, the refined coordinated is deposited to PDB with PDB ID 2MBM, which shows better Procheck and MolProbity quality score but with higher restraint violations. ; _exptl.entry_id 2MBL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MBL _struct.title 'Solution NMR Structure of De novo designed Top7 Fold Protein Top7m13, Northeast Structural Genomics Consortium (NESG) Target OR33' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MBL _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 29 ? GLY A 52 ? ARG A 29 GLY A 52 1 ? 24 HELX_P HELX_P2 2 ASP A 66 ? GLY A 89 ? ASP A 66 GLY A 89 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 14 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 53 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 14 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 53 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.034 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 17 ? ALA A 27 ? LYS A 17 ALA A 27 A 2 LYS A 4 ? CYS A 14 ? LYS A 4 CYS A 14 A 3 VAL A 56 ? VAL A 62 ? VAL A 56 VAL A 62 A 4 THR A 101 ? GLY A 106 ? THR A 101 GLY A 106 A 5 VAL A 95 ? TRP A 97 ? VAL A 95 TRP A 97 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 19 ? O TYR A 19 N ILE A 12 ? N ILE A 12 A 2 3 N GLN A 9 ? N GLN A 9 O ARG A 61 ? O ARG A 61 A 3 4 N ILE A 58 ? N ILE A 58 O VAL A 104 ? O VAL A 104 A 4 5 O THR A 103 ? O THR A 103 N THR A 96 ? N THR A 96 # _atom_sites.entry_id 2MBL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 TRP 97 97 97 TRP TRP A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 HIS 120 120 120 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-11-13 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id OR33.017-1 0.69 ? mM '[U-100% 13C; U-100% 15N]' 1 OR33.007-2 0.69 ? mM '[U-100% 13C; U-100% 15N]' 2 OR33.007_rdc-3 0.69 ? mM '[U-100% 13C; U-100% 15N]' 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 15 ? ? 78.49 -65.31 2 1 ASP A 100 ? ? 46.67 26.09 3 1 GLU A 109 ? ? 74.60 -73.21 4 1 ASP A 112 ? ? -171.82 144.60 5 2 ASN A 15 ? ? 71.57 -73.10 6 2 HIS A 116 ? ? -65.96 92.84 7 3 ASP A 92 ? ? 54.80 -81.19 8 3 GLU A 109 ? ? 84.12 -44.33 9 3 GLU A 114 ? ? -69.96 80.39 10 3 HIS A 115 ? ? -169.85 80.33 11 4 ASN A 15 ? ? 72.03 -74.02 12 4 ASP A 66 ? ? -109.29 -105.04 13 4 ALA A 67 ? ? 176.71 -60.25 14 4 GLU A 109 ? ? 42.56 22.45 15 4 VAL A 111 ? ? -69.15 -164.17 16 4 LEU A 113 ? ? -64.50 98.17 17 4 HIS A 117 ? ? -67.28 90.93 18 5 SER A 2 ? ? 67.62 167.96 19 5 HIS A 115 ? ? -67.33 79.26 20 6 ASN A 15 ? ? 75.89 -46.33 21 6 VAL A 111 ? ? -142.15 -61.95 22 6 ASP A 112 ? ? 177.23 136.61 23 7 ASN A 15 ? ? 74.30 -1.28 24 7 VAL A 111 ? ? 73.16 -58.14 25 7 ASP A 112 ? ? -54.30 103.62 26 7 HIS A 117 ? ? -148.84 34.65 27 8 ASP A 98 ? ? -101.63 75.57 28 8 HIS A 115 ? ? -158.78 71.69 29 8 HIS A 117 ? ? -47.98 83.73 30 8 HIS A 119 ? ? -152.61 54.45 31 9 CYS A 53 ? ? -69.99 99.30 32 9 ASP A 100 ? ? -175.04 -52.73 33 9 GLU A 109 ? ? -68.30 -179.10 34 9 ASP A 112 ? ? 78.46 -32.74 35 11 ASN A 15 ? ? 77.30 -8.61 36 11 VAL A 28 ? ? -76.00 -71.14 37 11 SER A 65 ? ? -164.91 32.66 38 11 ASP A 98 ? ? -152.31 73.93 39 11 VAL A 111 ? ? -91.75 56.88 40 11 HIS A 119 ? ? -143.06 -13.52 41 12 SER A 2 ? ? -99.40 36.59 42 12 ASN A 15 ? ? 72.08 -72.64 43 12 ASP A 92 ? ? -88.48 32.38 44 12 LEU A 113 ? ? -98.51 -65.35 45 12 HIS A 116 ? ? -88.33 34.44 46 12 HIS A 118 ? ? -61.74 98.11 47 13 ASP A 98 ? ? -159.40 81.76 48 13 HIS A 116 ? ? -63.62 94.73 49 14 HIS A 119 ? ? -146.08 33.33 50 15 ASN A 15 ? ? 70.22 30.29 51 16 SER A 2 ? ? -153.80 74.83 52 16 ASP A 92 ? ? 64.19 -72.09 53 16 HIS A 118 ? ? -56.45 107.39 54 17 ASN A 15 ? ? 69.97 -78.23 55 18 ASN A 15 ? ? 70.19 -80.45 56 18 LYS A 54 ? ? -63.73 -78.33 57 18 ASP A 100 ? ? 59.08 9.30 58 18 GLU A 109 ? ? -56.87 105.24 59 18 ASP A 112 ? ? -172.07 -36.81 60 18 LEU A 113 ? ? -68.48 82.12 61 18 HIS A 115 ? ? -66.40 96.47 62 18 HIS A 117 ? ? -68.01 86.89 63 19 SER A 65 ? ? -20.29 -68.35 64 19 ASN A 91 ? ? -116.44 -166.06 65 19 ASP A 112 ? ? 67.80 87.14 66 20 GLU A 109 ? ? 38.79 -78.90 67 20 VAL A 111 ? ? -62.57 92.63 #