data_2MDG # _entry.id 2MDG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MDG pdb_00002mdg 10.2210/pdb2mdg/pdb RCSB RCSB103504 ? ? BMRB 19486 ? 10.13018/BMR19486 WWPDB D_1000103504 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-09-25 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer 6 2 'Structure model' pdbx_struct_conn_angle 7 2 'Structure model' struct_conn 8 2 'Structure model' struct_ref_seq_dif 9 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.value' 18 2 'Structure model' '_struct_conn.pdbx_dist_value' 19 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 2 'Structure model' '_struct_ref_seq_dif.details' 27 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MDG _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-09-10 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19486 BMRB unspecified . NESG-HR7298F TargetTrack unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pederson, K.' 1 'Lee, D.' 2 'Kohan, E.' 3 'Janjua, H.' 4 'Xiao, R.' 5 'Everett, J.K.' 6 'Acton, T.B.' 7 'Montelione, G.T.' 8 'Prestegard, J.H.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title 'Solution NMR Structure of Zinc finger protein 423 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7298F' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pederson, K.' 1 ? primary 'Lee, D.' 2 ? primary 'Kohan, E.' 3 ? primary 'Janjua, H.' 4 ? primary 'Xiao, R.' 5 ? primary 'Everett, J.K.' 6 ? primary 'Acton, T.B.' 7 ? primary 'Montelione, G.T.' 8 ? primary 'Prestegard, J.H.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 423' 6337.325 1 ? ? 'UNP residues 928-981' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Olf1/EBF-associated zinc finger protein, hOAZ, Smad- and Olf-interacting zinc finger protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH _entity_poly.pdbx_seq_one_letter_code_can MGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-HR7298F # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 HIS n 1 5 LYS n 1 6 CYS n 1 7 ASN n 1 8 VAL n 1 9 CYS n 1 10 SER n 1 11 ARG n 1 12 THR n 1 13 PHE n 1 14 PHE n 1 15 SER n 1 16 GLU n 1 17 ASN n 1 18 GLY n 1 19 LEU n 1 20 ARG n 1 21 GLU n 1 22 HIS n 1 23 LEU n 1 24 GLN n 1 25 THR n 1 26 HIS n 1 27 ARG n 1 28 GLY n 1 29 PRO n 1 30 ALA n 1 31 LYS n 1 32 HIS n 1 33 TYR n 1 34 MET n 1 35 CYS n 1 36 PRO n 1 37 ILE n 1 38 CYS n 1 39 GLY n 1 40 GLU n 1 41 ARG n 1 42 PHE n 1 43 PRO n 1 44 SER n 1 45 LEU n 1 46 LEU n 1 47 THR n 1 48 LEU n 1 49 THR n 1 50 GLU n 1 51 HIS n 1 52 LYS n 1 53 VAL n 1 54 THR n 1 55 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KIAA0760, NPHP14, OAZ, ZNF423' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15Avi6HT_NESG _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 HIS 55 55 55 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 56 ZN ZN A . C 2 ZN 1 102 57 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;The NESG target Hr7298F contains two C2H2 zinc finger motifs between residues 928 and 981 of the Homo sapiens Zinc finger protein 423. Residual dipolar couplings suggest that the two zinc finger motifs are connected by flexible loops and not restricted with respect to one another. Therefore the positions of domains with respect to one another in the structures reported are not significant. ; _exptl.entry_id 2MDG _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MDG _struct.title 'Solution NMR Structure of Zinc finger protein 423 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7298F' _struct.pdbx_model_details 'fewest violations, model6' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MDG _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), Target HR7298F, PSI-Biology, Protein Structure Initiative, C2H2, DNA BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN423_HUMAN _struct_ref.pdbx_db_accession Q2M1K9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH _struct_ref.pdbx_align_begin 928 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MDG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 55 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2M1K9 _struct_ref_seq.db_align_beg 928 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 981 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 55 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2MDG _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q2M1K9 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? GLN A 24 ? SER A 15 GLN A 24 1 ? 10 HELX_P HELX_P2 2 THR A 25 ? ARG A 27 ? THR A 25 ARG A 27 5 ? 3 HELX_P HELX_P3 3 LEU A 46 ? THR A 54 ? LEU A 46 THR A 54 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 6 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 6 A ZN 101 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc2 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 9 A ZN 101 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc3 metalc ? ? A HIS 22 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 22 A ZN 101 1_555 ? ? ? ? ? ? ? 2.089 ? ? metalc4 metalc ? ? A HIS 26 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 101 1_555 ? ? ? ? ? ? ? 2.063 ? ? metalc5 metalc ? ? A CYS 35 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 35 A ZN 102 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc6 metalc ? ? A CYS 38 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 38 A ZN 102 1_555 ? ? ? ? ? ? ? 2.340 ? ? metalc7 metalc ? ? A HIS 51 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 51 A ZN 102 1_555 ? ? ? ? ? ? ? 2.078 ? ? metalc8 metalc ? ? A HIS 55 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 55 A ZN 102 1_555 ? ? ? ? ? ? ? 2.057 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 9 ? A CYS 9 ? 1_555 109.7 ? 2 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 107.8 ? 3 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 109.6 ? 4 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 107.7 ? 5 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 107.3 ? 6 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 114.7 ? 7 SG ? A CYS 35 ? A CYS 35 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 111.2 ? 8 SG ? A CYS 35 ? A CYS 35 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 106.3 ? 9 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 109.1 ? 10 SG ? A CYS 35 ? A CYS 35 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 107.4 ? 11 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 110.4 ? 12 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 112.4 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 33 ? MET A 34 ? TYR A 33 MET A 34 A 2 ARG A 41 ? PHE A 42 ? ARG A 41 PHE A 42 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 33 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 33 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 42 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 42 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 101 ? 4 'BINDING SITE FOR RESIDUE ZN A 101' AC2 Software A ZN 102 ? 4 'BINDING SITE FOR RESIDUE ZN A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 6 ? CYS A 6 . ? 1_555 ? 2 AC1 4 CYS A 9 ? CYS A 9 . ? 1_555 ? 3 AC1 4 HIS A 22 ? HIS A 22 . ? 1_555 ? 4 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? 5 AC2 4 CYS A 35 ? CYS A 35 . ? 1_555 ? 6 AC2 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 7 AC2 4 HIS A 51 ? HIS A 51 . ? 1_555 ? 8 AC2 4 HIS A 55 ? HIS A 55 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 3 _pdbx_validate_close_contact.auth_atom_id_1 HD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 PHE _pdbx_validate_close_contact.auth_seq_id_1 13 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 15 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.35 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 4 ? ? -59.54 96.80 2 1 ASN A 7 ? ? 77.14 -49.63 3 1 SER A 10 ? ? 70.30 -0.97 4 1 SER A 15 ? ? -172.06 -171.09 5 1 LYS A 31 ? ? -114.57 53.65 6 1 PRO A 43 ? ? -68.72 3.93 7 1 LEU A 46 ? ? -162.18 -55.22 8 2 HIS A 32 ? ? -142.15 42.33 9 2 LEU A 45 ? ? -95.57 54.33 10 2 LEU A 46 ? ? -137.25 -54.77 11 2 THR A 54 ? ? -90.15 36.12 12 3 SER A 10 ? ? 82.42 -11.37 13 3 LYS A 31 ? ? -158.32 36.34 14 3 HIS A 32 ? ? -97.42 38.98 15 3 LEU A 46 ? ? -146.63 -55.95 16 4 PHE A 14 ? ? -125.93 -52.17 17 4 LEU A 46 ? ? -156.71 -53.36 18 4 THR A 54 ? ? -97.95 38.48 19 5 HIS A 4 ? ? -109.42 70.09 20 5 PHE A 14 ? ? -135.56 -42.65 21 5 LEU A 46 ? ? -158.22 -54.71 22 6 HIS A 4 ? ? -68.78 76.75 23 6 CYS A 6 ? ? -55.50 104.05 24 6 HIS A 32 ? ? -174.31 141.98 25 6 LEU A 45 ? ? -90.98 47.75 26 6 LEU A 46 ? ? -144.69 -53.38 27 6 THR A 54 ? ? -95.66 33.96 28 7 PHE A 14 ? ? -65.21 1.12 29 7 HIS A 32 ? ? -175.43 -179.68 30 7 PRO A 36 ? ? -27.75 -55.80 31 7 LEU A 46 ? ? -149.96 -55.83 32 8 PHE A 14 ? ? -125.48 -59.19 33 8 ARG A 27 ? ? -70.32 38.03 34 8 HIS A 32 ? ? -111.64 74.86 35 8 LEU A 46 ? ? -152.10 -54.23 36 9 ALA A 30 ? ? -176.83 64.53 37 9 HIS A 32 ? ? 44.22 79.14 38 9 LEU A 45 ? ? -89.47 43.83 39 9 LEU A 46 ? ? -141.72 -53.87 40 9 THR A 54 ? ? -94.79 36.98 41 10 CYS A 9 ? ? -91.51 -86.82 42 10 SER A 10 ? ? 175.41 -51.20 43 10 ARG A 27 ? ? -89.48 32.96 44 10 ALA A 30 ? ? -56.80 74.59 45 10 LYS A 31 ? ? -144.78 17.49 46 10 LEU A 45 ? ? -91.50 43.07 47 10 LEU A 46 ? ? -139.02 -54.85 48 11 HIS A 4 ? ? -57.88 90.00 49 11 LYS A 31 ? ? -42.86 86.58 50 11 LEU A 45 ? ? -92.27 49.65 51 11 LEU A 46 ? ? -147.52 -51.29 52 11 THR A 54 ? ? -94.21 37.96 53 12 LEU A 45 ? ? -88.78 42.12 54 12 LEU A 46 ? ? -138.21 -53.58 55 13 SER A 10 ? ? 99.43 3.05 56 13 LYS A 31 ? ? -65.58 91.18 57 13 LEU A 45 ? ? -82.27 45.24 58 13 LEU A 46 ? ? -132.24 -55.47 59 14 HIS A 4 ? ? -62.71 87.79 60 14 CYS A 6 ? ? -73.34 22.37 61 14 ASN A 7 ? ? 52.35 -68.51 62 14 SER A 10 ? ? 46.03 74.87 63 14 ARG A 11 ? ? -125.00 -71.87 64 14 THR A 12 ? ? -179.92 -170.43 65 14 LEU A 45 ? ? -92.54 59.33 66 14 LEU A 46 ? ? -139.25 -48.27 67 15 SER A 3 ? ? -163.04 105.83 68 15 HIS A 26 ? ? -90.37 39.79 69 15 LEU A 46 ? ? -160.92 -55.51 70 16 PHE A 14 ? ? -133.77 -55.00 71 16 LYS A 31 ? ? 73.06 -57.70 72 16 LEU A 46 ? ? -150.45 -53.39 73 17 ARG A 11 ? ? -117.15 -158.83 74 17 LYS A 31 ? ? -154.13 69.42 75 17 LEU A 45 ? ? -87.15 36.48 76 17 LEU A 46 ? ? -130.42 -52.53 77 18 SER A 10 ? ? 91.54 17.76 78 18 PHE A 14 ? ? -120.52 -53.45 79 18 HIS A 26 ? ? -63.49 2.37 80 18 LEU A 46 ? ? -136.86 -56.07 81 18 THR A 54 ? ? -94.50 35.35 82 19 LEU A 45 ? ? -88.79 42.75 83 19 LEU A 46 ? ? -145.03 -51.29 84 20 ASN A 7 ? ? -11.22 -64.91 85 20 HIS A 32 ? ? 58.62 71.97 86 20 LEU A 46 ? ? -146.26 -51.05 87 20 THR A 54 ? ? -120.70 -57.54 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MDG _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MDG _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.17 mM [U-100% 13C; U-100% 15N] HR7298F.005, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 10 % [U-100% 2H] D2O, 50 uM DSS, 50 uM ZnSO4, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.51 mM [U-5% 13C; U-100% 15N] HR7298F.0059, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 10 % [U-100% 2H] D2O, 50 uM DSS, 4.2 % C12E5 PEG/Hexanol, 50 uM ZnSO4, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' ;0.51 mM [U-5% 13C; U-100% 15N] HR7298F.009, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 10 % [U-100% 2H] D2O, 50 uM DSS, 50 uM ZnSO4, 95% H2O/5% D2O ; 3 '95% H2O/5% D2O' ;0.17 mM [U-100% 13C; U-100% 15N] HR7298F.005, 0.02 % NaN3, 10 mM DTT, 5 mM CaCL2, 100 mM NaCL, 1 x Proteinase Inhibitors, 20 mM MES pH 6.5, 10 % [U-100% 2H] D2O, 50 uM DSS, 50 uM ZnSO4, 4.2 % C12E5 PEG?Hexanol, 90% H2O/10% D2O ; 4 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HR7298F.005-1 0.17 ? mM '[U-100% 13C; U-100% 15N]' 1 NaN3-2 0.02 ? % ? 1 DTT-3 10 ? mM ? 1 CaCL2-4 5 ? mM ? 1 NaCL-5 100 ? mM ? 1 'Proteinase Inhibitors-6' 1 ? % ? 1 'MES pH 6.5-7' 20 ? mM ? 1 D2O-8 10 ? % '[U-100% 2H]' 1 DSS-9 0.050 ? mM ? 1 ZnSO4-10 0.050 ? mM ? 1 HR7298F.0059-11 0.51 ? mM '[U-5% 13C; U-100% 15N]' 2 NaN3-12 0.02 ? % ? 2 DTT-13 10 ? mM ? 2 CaCL2-14 5 ? mM ? 2 NaCL-15 100 ? mM ? 2 'Proteinase Inhibitors-16' 1 ? % ? 2 'MES pH 6.5-17' 20 ? mM ? 2 D2O-18 10 ? % '[U-100% 2H]' 2 DSS-19 0.050 ? mM ? 2 'C12E5 PEG/Hexanol-20' 4.2 ? % ? 2 ZnSO4-21 0.050 ? mM ? 2 HR7298F.009-22 0.51 ? mM '[U-5% 13C; U-100% 15N]' 3 NaN3-23 0.02 ? % ? 3 DTT-24 10 ? mM ? 3 CaCL2-25 5 ? mM ? 3 NaCL-26 100 ? mM ? 3 'Proteinase Inhibitors-27' 1 ? % ? 3 'MES pH 6.5-28' 20 ? mM ? 3 D2O-29 10 ? % '[U-100% 2H]' 3 DSS-30 0.050 ? mM ? 3 ZnSO4-31 0.050 ? mM ? 3 HR7298F.005-32 0.17 ? mM '[U-100% 13C; U-100% 15N]' 4 NaN3-33 0.02 ? % ? 4 DTT-34 10 ? mM ? 4 CaCL2-35 5 ? mM ? 4 NaCL-36 100 ? mM ? 4 'Proteinase Inhibitors-37' 1 ? % ? 4 'MES pH 6.5-38' 20 ? mM ? 4 D2O-39 10 ? % '[U-100% 2H]' 4 DSS-40 0.050 ? mM ? 4 ZnSO4-41 0.050 ? mM ? 4 'C12E5 PEG?Hexanol-42' 4.2 ? % ? 4 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 3 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY aliphatic' 1 10 3 '2D 1H-13C CT HSQC' 1 11 1 '2D 1H-15N J-modulation HSQC' 1 12 2 '2D 1H-15N J-modulation HSQC' 1 13 1 '2D 1H-15N CO filtered TROSY' 1 14 4 '2D 1H-15N CO-filtered TROSY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MDG _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 330 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 146 _pdbx_nmr_constraints.NOE_long_range_total_count 50 _pdbx_nmr_constraints.NOE_medium_range_total_count 41 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 93 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 37 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 38 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'refinemen,structure solution,geometry optimization' CNS 1.3 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 Varian collection VnmrJ ? 4 Goddard 'chemical shift assignment' Sparky 3.113 5 'PALES (Zweckstetter, Bax)' 'structure validation' PALES ? 6 'Bhattacharya, Montelione' 'structure validation' PSVS 1.5 7 ? refinement CNS ? 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 ILE N N N N 142 ILE CA C N S 143 ILE C C N N 144 ILE O O N N 145 ILE CB C N S 146 ILE CG1 C N N 147 ILE CG2 C N N 148 ILE CD1 C N N 149 ILE OXT O N N 150 ILE H H N N 151 ILE H2 H N N 152 ILE HA H N N 153 ILE HB H N N 154 ILE HG12 H N N 155 ILE HG13 H N N 156 ILE HG21 H N N 157 ILE HG22 H N N 158 ILE HG23 H N N 159 ILE HD11 H N N 160 ILE HD12 H N N 161 ILE HD13 H N N 162 ILE HXT H N N 163 LEU N N N N 164 LEU CA C N S 165 LEU C C N N 166 LEU O O N N 167 LEU CB C N N 168 LEU CG C N N 169 LEU CD1 C N N 170 LEU CD2 C N N 171 LEU OXT O N N 172 LEU H H N N 173 LEU H2 H N N 174 LEU HA H N N 175 LEU HB2 H N N 176 LEU HB3 H N N 177 LEU HG H N N 178 LEU HD11 H N N 179 LEU HD12 H N N 180 LEU HD13 H N N 181 LEU HD21 H N N 182 LEU HD22 H N N 183 LEU HD23 H N N 184 LEU HXT H N N 185 LYS N N N N 186 LYS CA C N S 187 LYS C C N N 188 LYS O O N N 189 LYS CB C N N 190 LYS CG C N N 191 LYS CD C N N 192 LYS CE C N N 193 LYS NZ N N N 194 LYS OXT O N N 195 LYS H H N N 196 LYS H2 H N N 197 LYS HA H N N 198 LYS HB2 H N N 199 LYS HB3 H N N 200 LYS HG2 H N N 201 LYS HG3 H N N 202 LYS HD2 H N N 203 LYS HD3 H N N 204 LYS HE2 H N N 205 LYS HE3 H N N 206 LYS HZ1 H N N 207 LYS HZ2 H N N 208 LYS HZ3 H N N 209 LYS HXT H N N 210 MET N N N N 211 MET CA C N S 212 MET C C N N 213 MET O O N N 214 MET CB C N N 215 MET CG C N N 216 MET SD S N N 217 MET CE C N N 218 MET OXT O N N 219 MET H H N N 220 MET H2 H N N 221 MET HA H N N 222 MET HB2 H N N 223 MET HB3 H N N 224 MET HG2 H N N 225 MET HG3 H N N 226 MET HE1 H N N 227 MET HE2 H N N 228 MET HE3 H N N 229 MET HXT H N N 230 PHE N N N N 231 PHE CA C N S 232 PHE C C N N 233 PHE O O N N 234 PHE CB C N N 235 PHE CG C Y N 236 PHE CD1 C Y N 237 PHE CD2 C Y N 238 PHE CE1 C Y N 239 PHE CE2 C Y N 240 PHE CZ C Y N 241 PHE OXT O N N 242 PHE H H N N 243 PHE H2 H N N 244 PHE HA H N N 245 PHE HB2 H N N 246 PHE HB3 H N N 247 PHE HD1 H N N 248 PHE HD2 H N N 249 PHE HE1 H N N 250 PHE HE2 H N N 251 PHE HZ H N N 252 PHE HXT H N N 253 PRO N N N N 254 PRO CA C N S 255 PRO C C N N 256 PRO O O N N 257 PRO CB C N N 258 PRO CG C N N 259 PRO CD C N N 260 PRO OXT O N N 261 PRO H H N N 262 PRO HA H N N 263 PRO HB2 H N N 264 PRO HB3 H N N 265 PRO HG2 H N N 266 PRO HG3 H N N 267 PRO HD2 H N N 268 PRO HD3 H N N 269 PRO HXT H N N 270 SER N N N N 271 SER CA C N S 272 SER C C N N 273 SER O O N N 274 SER CB C N N 275 SER OG O N N 276 SER OXT O N N 277 SER H H N N 278 SER H2 H N N 279 SER HA H N N 280 SER HB2 H N N 281 SER HB3 H N N 282 SER HG H N N 283 SER HXT H N N 284 THR N N N N 285 THR CA C N S 286 THR C C N N 287 THR O O N N 288 THR CB C N R 289 THR OG1 O N N 290 THR CG2 C N N 291 THR OXT O N N 292 THR H H N N 293 THR H2 H N N 294 THR HA H N N 295 THR HB H N N 296 THR HG1 H N N 297 THR HG21 H N N 298 THR HG22 H N N 299 THR HG23 H N N 300 THR HXT H N N 301 TYR N N N N 302 TYR CA C N S 303 TYR C C N N 304 TYR O O N N 305 TYR CB C N N 306 TYR CG C Y N 307 TYR CD1 C Y N 308 TYR CD2 C Y N 309 TYR CE1 C Y N 310 TYR CE2 C Y N 311 TYR CZ C Y N 312 TYR OH O N N 313 TYR OXT O N N 314 TYR H H N N 315 TYR H2 H N N 316 TYR HA H N N 317 TYR HB2 H N N 318 TYR HB3 H N N 319 TYR HD1 H N N 320 TYR HD2 H N N 321 TYR HE1 H N N 322 TYR HE2 H N N 323 TYR HH H N N 324 TYR HXT H N N 325 VAL N N N N 326 VAL CA C N S 327 VAL C C N N 328 VAL O O N N 329 VAL CB C N N 330 VAL CG1 C N N 331 VAL CG2 C N N 332 VAL OXT O N N 333 VAL H H N N 334 VAL H2 H N N 335 VAL HA H N N 336 VAL HB H N N 337 VAL HG11 H N N 338 VAL HG12 H N N 339 VAL HG13 H N N 340 VAL HG21 H N N 341 VAL HG22 H N N 342 VAL HG23 H N N 343 VAL HXT H N N 344 ZN ZN ZN N N 345 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 ILE N CA sing N N 135 ILE N H sing N N 136 ILE N H2 sing N N 137 ILE CA C sing N N 138 ILE CA CB sing N N 139 ILE CA HA sing N N 140 ILE C O doub N N 141 ILE C OXT sing N N 142 ILE CB CG1 sing N N 143 ILE CB CG2 sing N N 144 ILE CB HB sing N N 145 ILE CG1 CD1 sing N N 146 ILE CG1 HG12 sing N N 147 ILE CG1 HG13 sing N N 148 ILE CG2 HG21 sing N N 149 ILE CG2 HG22 sing N N 150 ILE CG2 HG23 sing N N 151 ILE CD1 HD11 sing N N 152 ILE CD1 HD12 sing N N 153 ILE CD1 HD13 sing N N 154 ILE OXT HXT sing N N 155 LEU N CA sing N N 156 LEU N H sing N N 157 LEU N H2 sing N N 158 LEU CA C sing N N 159 LEU CA CB sing N N 160 LEU CA HA sing N N 161 LEU C O doub N N 162 LEU C OXT sing N N 163 LEU CB CG sing N N 164 LEU CB HB2 sing N N 165 LEU CB HB3 sing N N 166 LEU CG CD1 sing N N 167 LEU CG CD2 sing N N 168 LEU CG HG sing N N 169 LEU CD1 HD11 sing N N 170 LEU CD1 HD12 sing N N 171 LEU CD1 HD13 sing N N 172 LEU CD2 HD21 sing N N 173 LEU CD2 HD22 sing N N 174 LEU CD2 HD23 sing N N 175 LEU OXT HXT sing N N 176 LYS N CA sing N N 177 LYS N H sing N N 178 LYS N H2 sing N N 179 LYS CA C sing N N 180 LYS CA CB sing N N 181 LYS CA HA sing N N 182 LYS C O doub N N 183 LYS C OXT sing N N 184 LYS CB CG sing N N 185 LYS CB HB2 sing N N 186 LYS CB HB3 sing N N 187 LYS CG CD sing N N 188 LYS CG HG2 sing N N 189 LYS CG HG3 sing N N 190 LYS CD CE sing N N 191 LYS CD HD2 sing N N 192 LYS CD HD3 sing N N 193 LYS CE NZ sing N N 194 LYS CE HE2 sing N N 195 LYS CE HE3 sing N N 196 LYS NZ HZ1 sing N N 197 LYS NZ HZ2 sing N N 198 LYS NZ HZ3 sing N N 199 LYS OXT HXT sing N N 200 MET N CA sing N N 201 MET N H sing N N 202 MET N H2 sing N N 203 MET CA C sing N N 204 MET CA CB sing N N 205 MET CA HA sing N N 206 MET C O doub N N 207 MET C OXT sing N N 208 MET CB CG sing N N 209 MET CB HB2 sing N N 210 MET CB HB3 sing N N 211 MET CG SD sing N N 212 MET CG HG2 sing N N 213 MET CG HG3 sing N N 214 MET SD CE sing N N 215 MET CE HE1 sing N N 216 MET CE HE2 sing N N 217 MET CE HE3 sing N N 218 MET OXT HXT sing N N 219 PHE N CA sing N N 220 PHE N H sing N N 221 PHE N H2 sing N N 222 PHE CA C sing N N 223 PHE CA CB sing N N 224 PHE CA HA sing N N 225 PHE C O doub N N 226 PHE C OXT sing N N 227 PHE CB CG sing N N 228 PHE CB HB2 sing N N 229 PHE CB HB3 sing N N 230 PHE CG CD1 doub Y N 231 PHE CG CD2 sing Y N 232 PHE CD1 CE1 sing Y N 233 PHE CD1 HD1 sing N N 234 PHE CD2 CE2 doub Y N 235 PHE CD2 HD2 sing N N 236 PHE CE1 CZ doub Y N 237 PHE CE1 HE1 sing N N 238 PHE CE2 CZ sing Y N 239 PHE CE2 HE2 sing N N 240 PHE CZ HZ sing N N 241 PHE OXT HXT sing N N 242 PRO N CA sing N N 243 PRO N CD sing N N 244 PRO N H sing N N 245 PRO CA C sing N N 246 PRO CA CB sing N N 247 PRO CA HA sing N N 248 PRO C O doub N N 249 PRO C OXT sing N N 250 PRO CB CG sing N N 251 PRO CB HB2 sing N N 252 PRO CB HB3 sing N N 253 PRO CG CD sing N N 254 PRO CG HG2 sing N N 255 PRO CG HG3 sing N N 256 PRO CD HD2 sing N N 257 PRO CD HD3 sing N N 258 PRO OXT HXT sing N N 259 SER N CA sing N N 260 SER N H sing N N 261 SER N H2 sing N N 262 SER CA C sing N N 263 SER CA CB sing N N 264 SER CA HA sing N N 265 SER C O doub N N 266 SER C OXT sing N N 267 SER CB OG sing N N 268 SER CB HB2 sing N N 269 SER CB HB3 sing N N 270 SER OG HG sing N N 271 SER OXT HXT sing N N 272 THR N CA sing N N 273 THR N H sing N N 274 THR N H2 sing N N 275 THR CA C sing N N 276 THR CA CB sing N N 277 THR CA HA sing N N 278 THR C O doub N N 279 THR C OXT sing N N 280 THR CB OG1 sing N N 281 THR CB CG2 sing N N 282 THR CB HB sing N N 283 THR OG1 HG1 sing N N 284 THR CG2 HG21 sing N N 285 THR CG2 HG22 sing N N 286 THR CG2 HG23 sing N N 287 THR OXT HXT sing N N 288 TYR N CA sing N N 289 TYR N H sing N N 290 TYR N H2 sing N N 291 TYR CA C sing N N 292 TYR CA CB sing N N 293 TYR CA HA sing N N 294 TYR C O doub N N 295 TYR C OXT sing N N 296 TYR CB CG sing N N 297 TYR CB HB2 sing N N 298 TYR CB HB3 sing N N 299 TYR CG CD1 doub Y N 300 TYR CG CD2 sing Y N 301 TYR CD1 CE1 sing Y N 302 TYR CD1 HD1 sing N N 303 TYR CD2 CE2 doub Y N 304 TYR CD2 HD2 sing N N 305 TYR CE1 CZ doub Y N 306 TYR CE1 HE1 sing N N 307 TYR CE2 CZ sing Y N 308 TYR CE2 HE2 sing N N 309 TYR CZ OH sing N N 310 TYR OH HH sing N N 311 TYR OXT HXT sing N N 312 VAL N CA sing N N 313 VAL N H sing N N 314 VAL N H2 sing N N 315 VAL CA C sing N N 316 VAL CA CB sing N N 317 VAL CA HA sing N N 318 VAL C O doub N N 319 VAL C OXT sing N N 320 VAL CB CG1 sing N N 321 VAL CB CG2 sing N N 322 VAL CB HB sing N N 323 VAL CG1 HG11 sing N N 324 VAL CG1 HG12 sing N N 325 VAL CG1 HG13 sing N N 326 VAL CG2 HG21 sing N N 327 VAL CG2 HG22 sing N N 328 VAL CG2 HG23 sing N N 329 VAL OXT HXT sing N N 330 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 900 Varian AVANCE 2 'Varian Avance' 600 Varian AVANCE 3 'Varian Avance' # _atom_sites.entry_id 2MDG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_