data_2MDP # _entry.id 2MDP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MDP pdb_00002mdp 10.2210/pdb2mdp/pdb RCSB RCSB103512 ? ? BMRB 19498 ? ? WWPDB D_1000103512 ? ? # _pdbx_database_related.db_id 19498 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MDP _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-09-16 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mueller, G.A.' 1 'London, R.E.' 2 # _citation.id primary _citation.title 'The bacteriophage T7 encoded inhibitor (gp1.2) of E. coli dGTP triphosphohydrolase' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Singh, D.' 1 ? primary 'Mueller, G.A.' 2 ? primary 'Smith, C.E.' 3 ? primary 'Krahn, J.M.' 4 ? primary 'London, R.E.' 5 ? primary 'Schaaper, R.M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Gene 1.2 protein' _entity.formula_weight 10203.461 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQ LKDWK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQ LKDWK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ARG n 1 4 LEU n 1 5 TYR n 1 6 SER n 1 7 GLY n 1 8 ASN n 1 9 LEU n 1 10 ALA n 1 11 ALA n 1 12 PHE n 1 13 LYS n 1 14 ALA n 1 15 ALA n 1 16 THR n 1 17 ASN n 1 18 LYS n 1 19 LEU n 1 20 PHE n 1 21 GLN n 1 22 LEU n 1 23 ASP n 1 24 LEU n 1 25 ALA n 1 26 VAL n 1 27 ILE n 1 28 TYR n 1 29 ASP n 1 30 ASP n 1 31 TRP n 1 32 TYR n 1 33 ASP n 1 34 ALA n 1 35 TYR n 1 36 THR n 1 37 ARG n 1 38 LYS n 1 39 ASP n 1 40 CYS n 1 41 ILE n 1 42 ARG n 1 43 LEU n 1 44 ARG n 1 45 ILE n 1 46 GLU n 1 47 ASP n 1 48 ARG n 1 49 SER n 1 50 GLY n 1 51 ASN n 1 52 LEU n 1 53 ILE n 1 54 ASP n 1 55 THR n 1 56 SER n 1 57 THR n 1 58 PHE n 1 59 TYR n 1 60 HIS n 1 61 HIS n 1 62 ASP n 1 63 GLU n 1 64 ASP n 1 65 VAL n 1 66 LEU n 1 67 PHE n 1 68 ASN n 1 69 MET n 1 70 CYS n 1 71 THR n 1 72 ASP n 1 73 TRP n 1 74 LEU n 1 75 ASN n 1 76 HIS n 1 77 MET n 1 78 TYR n 1 79 ASP n 1 80 GLN n 1 81 LEU n 1 82 LYS n 1 83 ASP n 1 84 TRP n 1 85 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 1.2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T7' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10760 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pDest566 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code V12_BPT7 _struct_ref.pdbx_db_accession P03780 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQ LKDWK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MDP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03780 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D C(CO)NH' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D HNCACB' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 69.8 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.2 mM [U-100% 13C; U-100% 15N] protein, 46 mM sodium chloride, 1 mM potassium chloride, 1.4 mM sodium phosphate, 0.05 mM potassium phosphate, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.2 mM [U-100% 13C; U-100% 15N] protein, 46 mM sodium chloride, 1 mM potassium chloride, 1.4 mM sodium phosphate, 0.05 mM potassium phosphate, 50 mg/mL Pf1 phage, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2MDP _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'water refinement in explicit solvent' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 120 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MDP _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MDP _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 3 'Shen, Vernon, Baker and Bax' 'data analysis' CS-ROSETTA ? 4 'Herrmann, Guntert and Wuthrich' 'structure solution' CYANA ? 5 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MDP _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MDP _struct.title 'The bacteriophage T7 encoded inhibitor (gp1.2) of E. coli dGTP triphosphohydrolase' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MDP _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'dNTPase inhibitor, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 8 ? LEU A 22 ? ASN A 8 LEU A 22 1 ? 15 HELX_P HELX_P2 2 ASP A 62 ? TRP A 84 ? ASP A 62 TRP A 84 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 25 ? ASP A 29 ? ALA A 25 ASP A 29 A 2 ILE A 41 ? GLU A 46 ? ILE A 41 GLU A 46 A 3 LEU A 52 ? PHE A 58 ? LEU A 52 PHE A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 27 ? N ILE A 27 O ARG A 44 ? O ARG A 44 A 2 3 N LEU A 43 ? N LEU A 43 O SER A 56 ? O SER A 56 # _atom_sites.entry_id 2MDP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 LYS 85 85 85 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-04-20 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 0.2 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium chloride-2' 46 ? mM ? 1 'potassium chloride-3' 1 ? mM ? 1 'sodium phosphate-4' 1.4 ? mM ? 1 'potassium phosphate-5' 0.05 ? mM ? 1 entity-6 0.2 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium chloride-7' 46 ? mM ? 2 'potassium chloride-8' 1 ? mM ? 2 'sodium phosphate-9' 1.4 ? mM ? 2 'potassium phosphate-10' 0.05 ? mM ? 2 'Pf1 phage-11' 50 ? mg/mL ? 2 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 2 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 39 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH11 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 42 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 31 ? ? 95.84 -3.60 2 1 ALA A 34 ? ? -76.51 -116.18 3 1 ASP A 47 ? ? -86.54 -159.87 4 1 ILE A 53 ? ? -97.80 -61.20 5 1 HIS A 60 ? ? -173.63 -156.62 6 1 ASP A 62 ? ? -40.69 179.61 7 2 ASN A 8 ? ? -143.63 -9.37 8 2 ASP A 30 ? ? -161.48 118.84 9 2 CYS A 40 ? ? -144.43 -85.73 10 2 LEU A 52 ? ? 42.24 99.49 11 2 TYR A 59 ? ? -160.44 119.55 12 2 HIS A 60 ? ? -167.99 -133.88 13 2 ASP A 62 ? ? -39.78 170.17 14 3 ASP A 23 ? ? 71.79 38.53 15 3 ALA A 34 ? ? 64.60 78.95 16 3 THR A 36 ? ? -67.60 34.68 17 3 ARG A 37 ? ? 95.00 35.41 18 3 ASN A 51 ? ? -59.64 172.83 19 3 ILE A 53 ? ? -100.45 -61.12 20 3 HIS A 60 ? ? -172.25 134.51 21 4 TYR A 5 ? ? -146.46 -71.77 22 4 ASN A 8 ? ? -175.47 -44.97 23 4 SER A 49 ? ? -86.51 -72.84 24 4 ILE A 53 ? ? -105.87 -61.95 25 4 HIS A 60 ? ? -179.56 -70.95 26 4 ASP A 62 ? ? -42.74 172.94 27 5 TRP A 31 ? ? 168.15 22.12 28 5 ASP A 33 ? ? 60.80 102.59 29 5 ALA A 34 ? ? -168.19 86.80 30 5 CYS A 40 ? ? -176.87 121.53 31 6 TRP A 31 ? ? 48.87 77.33 32 6 TYR A 32 ? ? -95.94 -80.36 33 6 ASP A 33 ? ? -148.09 50.95 34 6 THR A 36 ? ? -84.54 35.18 35 6 ARG A 37 ? ? -36.25 -32.54 36 6 LYS A 38 ? ? -64.88 -176.30 37 6 HIS A 60 ? ? 170.40 121.15 38 7 ASN A 8 ? ? -76.66 -80.56 39 7 LEU A 9 ? ? -61.90 10.57 40 7 TRP A 31 ? ? -163.36 3.84 41 7 ASP A 33 ? ? -84.02 -158.41 42 7 ALA A 34 ? ? -178.84 75.93 43 7 ARG A 37 ? ? 68.90 94.45 44 7 LYS A 38 ? ? -101.91 -60.38 45 7 ASP A 39 ? ? 66.04 94.58 46 7 HIS A 60 ? ? 176.53 122.44 47 7 TRP A 84 ? ? -157.84 82.85 48 8 TRP A 31 ? ? 53.68 151.91 49 8 ARG A 37 ? ? 47.87 97.90 50 8 CYS A 40 ? ? -171.74 104.51 51 8 HIS A 60 ? ? -174.82 -155.93 52 8 ASP A 62 ? ? -43.16 159.56 53 8 GLU A 63 ? ? -35.63 -32.58 54 9 SER A 6 ? ? -83.06 -76.62 55 9 ASN A 8 ? ? -128.32 -61.90 56 9 LEU A 9 ? ? -65.42 3.93 57 9 CYS A 40 ? ? -157.67 -90.08 58 9 ILE A 53 ? ? -102.43 -62.20 59 9 HIS A 60 ? ? -171.41 -166.95 60 9 ASP A 62 ? ? -36.66 142.37 61 9 GLU A 63 ? ? -39.40 -24.48 62 9 TRP A 84 ? ? -81.77 47.83 63 10 ARG A 3 ? ? -171.16 114.31 64 10 SER A 6 ? ? -166.43 -158.69 65 10 ASN A 8 ? ? 71.11 -9.97 66 10 ASP A 23 ? ? 71.37 42.15 67 10 TRP A 31 ? ? 92.44 108.51 68 10 ALA A 34 ? ? 179.93 80.23 69 10 ARG A 37 ? ? 69.61 -173.77 70 10 CYS A 40 ? ? -113.72 -162.52 71 10 ILE A 53 ? ? -94.86 -61.18 #