data_2MOF # _entry.id 2MOF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MOF pdb_00002mof 10.2210/pdb2mof/pdb RCSB RCSB103858 ? ? BMRB 19941 ? 10.13018/BMR19941 WWPDB D_1000103858 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-29 2 'Structure model' 1 1 2015-01-14 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MOF _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-04-25 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19941 BMRB unspecified . 2MOM PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tjandra, N.' 1 'Rout, A.' 2 # _citation.id primary _citation.title ;Structure of Transmembrane Domain of Lysosome-associated Membrane Protein Type 2a (LAMP-2A) Reveals Key Features for Substrate Specificity in Chaperone-mediated Autophagy. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 289 _citation.page_first 35111 _citation.page_last 35123 _citation.year 2014 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25342746 _citation.pdbx_database_id_DOI 10.1074/jbc.M114.609446 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rout, A.K.' 1 ? primary 'Strub, M.P.' 2 ? primary 'Piszczek, G.' 3 ? primary 'Tjandra, N.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Lysosome-associated membrane glycoprotein 2' _entity.formula_weight 4484.159 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'unp residues 369-410' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LAMP-2, Lysosome-associated membrane protein 2, CD107 antigen-like family member B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF _entity_poly.pdbx_seq_one_letter_code_can SADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 ASP n 1 4 ASP n 1 5 ASP n 1 6 ASN n 1 7 PHE n 1 8 LEU n 1 9 VAL n 1 10 PRO n 1 11 ILE n 1 12 ALA n 1 13 VAL n 1 14 GLY n 1 15 ALA n 1 16 ALA n 1 17 LEU n 1 18 ALA n 1 19 GLY n 1 20 VAL n 1 21 LEU n 1 22 ILE n 1 23 LEU n 1 24 VAL n 1 25 LEU n 1 26 LEU n 1 27 ALA n 1 28 TYR n 1 29 PHE n 1 30 ILE n 1 31 GLY n 1 32 LEU n 1 33 LYS n 1 34 HIS n 1 35 HIS n 1 36 HIS n 1 37 ALA n 1 38 GLY n 1 39 TYR n 1 40 GLU n 1 41 GLN n 1 42 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LAMP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pMAL2px _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 369 369 SER SER A . n A 1 2 ALA 2 370 370 ALA ALA A . n A 1 3 ASP 3 371 371 ASP ASP A . n A 1 4 ASP 4 372 372 ASP ASP A . n A 1 5 ASP 5 373 373 ASP ASP A . n A 1 6 ASN 6 374 374 ASN ASN A . n A 1 7 PHE 7 375 375 PHE PHE A . n A 1 8 LEU 8 376 376 LEU LEU A . n A 1 9 VAL 9 377 377 VAL VAL A . n A 1 10 PRO 10 378 378 PRO PRO A . n A 1 11 ILE 11 379 379 ILE ILE A . n A 1 12 ALA 12 380 380 ALA ALA A . n A 1 13 VAL 13 381 381 VAL VAL A . n A 1 14 GLY 14 382 382 GLY GLY A . n A 1 15 ALA 15 383 383 ALA ALA A . n A 1 16 ALA 16 384 384 ALA ALA A . n A 1 17 LEU 17 385 385 LEU LEU A . n A 1 18 ALA 18 386 386 ALA ALA A . n A 1 19 GLY 19 387 387 GLY GLY A . n A 1 20 VAL 20 388 388 VAL VAL A . n A 1 21 LEU 21 389 389 LEU LEU A . n A 1 22 ILE 22 390 390 ILE ILE A . n A 1 23 LEU 23 391 391 LEU LEU A . n A 1 24 VAL 24 392 392 VAL VAL A . n A 1 25 LEU 25 393 393 LEU LEU A . n A 1 26 LEU 26 394 394 LEU LEU A . n A 1 27 ALA 27 395 395 ALA ALA A . n A 1 28 TYR 28 396 396 TYR TYR A . n A 1 29 PHE 29 397 397 PHE PHE A . n A 1 30 ILE 30 398 398 ILE ILE A . n A 1 31 GLY 31 399 399 GLY GLY A . n A 1 32 LEU 32 400 400 LEU LEU A . n A 1 33 LYS 33 401 401 LYS LYS A . n A 1 34 HIS 34 402 402 HIS HIS A . n A 1 35 HIS 35 403 403 HIS HIS A . n A 1 36 HIS 36 404 404 HIS HIS A . n A 1 37 ALA 37 405 405 ALA ALA A . n A 1 38 GLY 38 406 406 GLY GLY A . n A 1 39 TYR 39 407 407 TYR TYR A . n A 1 40 GLU 40 408 408 GLU GLU A . n A 1 41 GLN 41 409 409 GLN GLN A . n A 1 42 PHE 42 410 410 PHE PHE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MOF _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MOF _struct.title 'Structural insights of TM domain of LAMP-2A in DPC micelles' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MOF _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LAMP2_HUMAN _struct_ref.pdbx_db_accession P13473 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF _struct_ref.pdbx_align_begin 369 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MOF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P13473 _struct_ref_seq.db_align_beg 369 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 410 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 369 _struct_ref_seq.pdbx_auth_seq_align_end 410 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 11 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 379 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 401 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 11 _pdbx_validate_close_contact.auth_atom_id_1 H1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 369 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ALA _pdbx_validate_close_contact.auth_seq_id_2 370 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 377 ? ? 44.06 73.33 2 1 LYS A 401 ? ? 59.20 140.62 3 2 VAL A 377 ? ? 31.37 74.48 4 2 ALA A 380 ? ? -42.05 -19.93 5 3 ASP A 373 ? ? 56.36 -173.87 6 3 ALA A 380 ? ? -42.52 -19.67 7 4 ALA A 380 ? ? -40.89 -19.83 8 4 HIS A 402 ? ? 69.96 -38.65 9 5 ALA A 380 ? ? -40.91 -19.88 10 6 PHE A 375 ? ? 51.67 12.85 11 6 VAL A 377 ? ? -169.83 77.80 12 6 ALA A 380 ? ? -42.17 -19.73 13 7 ASP A 371 ? ? -154.67 -140.25 14 7 HIS A 402 ? ? 45.93 93.34 15 8 ALA A 380 ? ? -41.80 -19.82 16 9 ALA A 380 ? ? -41.34 -19.83 17 10 PHE A 375 ? ? 41.38 92.99 18 10 LEU A 376 ? ? -53.87 -171.12 19 10 VAL A 377 ? ? 31.31 69.07 20 10 ALA A 380 ? ? -41.51 -19.83 21 11 VAL A 377 ? ? 32.82 60.37 22 11 ALA A 380 ? ? -43.37 -19.70 23 12 ILE A 379 ? ? -96.73 -74.70 24 12 HIS A 402 ? ? 56.43 160.43 25 13 VAL A 377 ? ? 61.20 74.37 26 14 VAL A 377 ? ? 59.75 75.08 27 14 LYS A 401 ? ? 58.09 154.17 28 15 VAL A 377 ? ? 30.24 71.90 29 15 ALA A 380 ? ? -41.97 -19.53 30 15 HIS A 402 ? ? 45.63 84.03 31 16 ALA A 370 ? ? 61.81 109.53 32 16 ASP A 372 ? ? 57.52 -176.76 33 16 PHE A 375 ? ? -81.77 -137.06 34 16 VAL A 377 ? ? 32.41 74.35 35 16 ALA A 380 ? ? -42.06 -19.65 36 18 PHE A 375 ? ? -57.33 83.23 37 18 VAL A 377 ? ? 31.74 70.11 38 18 ALA A 380 ? ? -42.30 -19.76 39 18 HIS A 402 ? ? 53.76 90.69 40 19 VAL A 377 ? ? 54.94 75.08 41 19 LYS A 401 ? ? 51.67 103.73 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MOF _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MOF _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.6 mM [U-99% 15N] TM domain of LAMP2A, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.6 mM [U-99% 13C; U-99% 15N] TM domain of LAMP2A, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.6 mM [U-99% 13C; U-99% 15N] TM domain of LAMP2A, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'TM domain of LAMP2A-1' 0.6 ? mM '[U-99% 15N]' 1 'TM domain of LAMP2A-2' 0.6 ? mM '[U-99% 13C; U-99% 15N]' 2 'TM domain of LAMP2A-3' 0.6 ? mM '[U-99% 13C; U-99% 15N]' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D HNCO' 1 3 2 '3D HNCA' 1 4 2 '3D HN(CO)CA' 1 5 2 '3D CBCA(CO)NH' 1 6 2 '3D HNCACB' 1 7 1 '3D 1H-15N NOESY' 1 8 3 '4D HCCH NOESY' 1 9 3 '3D 13C Filter NOESY' # _pdbx_nmr_refine.entry_id 2MOF _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 2 Garrett 'data analysis' PIPP ? 3 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 4 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LYS N N N N 161 LYS CA C N S 162 LYS C C N N 163 LYS O O N N 164 LYS CB C N N 165 LYS CG C N N 166 LYS CD C N N 167 LYS CE C N N 168 LYS NZ N N N 169 LYS OXT O N N 170 LYS H H N N 171 LYS H2 H N N 172 LYS HA H N N 173 LYS HB2 H N N 174 LYS HB3 H N N 175 LYS HG2 H N N 176 LYS HG3 H N N 177 LYS HD2 H N N 178 LYS HD3 H N N 179 LYS HE2 H N N 180 LYS HE3 H N N 181 LYS HZ1 H N N 182 LYS HZ2 H N N 183 LYS HZ3 H N N 184 LYS HXT H N N 185 PHE N N N N 186 PHE CA C N S 187 PHE C C N N 188 PHE O O N N 189 PHE CB C N N 190 PHE CG C Y N 191 PHE CD1 C Y N 192 PHE CD2 C Y N 193 PHE CE1 C Y N 194 PHE CE2 C Y N 195 PHE CZ C Y N 196 PHE OXT O N N 197 PHE H H N N 198 PHE H2 H N N 199 PHE HA H N N 200 PHE HB2 H N N 201 PHE HB3 H N N 202 PHE HD1 H N N 203 PHE HD2 H N N 204 PHE HE1 H N N 205 PHE HE2 H N N 206 PHE HZ H N N 207 PHE HXT H N N 208 PRO N N N N 209 PRO CA C N S 210 PRO C C N N 211 PRO O O N N 212 PRO CB C N N 213 PRO CG C N N 214 PRO CD C N N 215 PRO OXT O N N 216 PRO H H N N 217 PRO HA H N N 218 PRO HB2 H N N 219 PRO HB3 H N N 220 PRO HG2 H N N 221 PRO HG3 H N N 222 PRO HD2 H N N 223 PRO HD3 H N N 224 PRO HXT H N N 225 SER N N N N 226 SER CA C N S 227 SER C C N N 228 SER O O N N 229 SER CB C N N 230 SER OG O N N 231 SER OXT O N N 232 SER H H N N 233 SER H2 H N N 234 SER HA H N N 235 SER HB2 H N N 236 SER HB3 H N N 237 SER HG H N N 238 SER HXT H N N 239 TYR N N N N 240 TYR CA C N S 241 TYR C C N N 242 TYR O O N N 243 TYR CB C N N 244 TYR CG C Y N 245 TYR CD1 C Y N 246 TYR CD2 C Y N 247 TYR CE1 C Y N 248 TYR CE2 C Y N 249 TYR CZ C Y N 250 TYR OH O N N 251 TYR OXT O N N 252 TYR H H N N 253 TYR H2 H N N 254 TYR HA H N N 255 TYR HB2 H N N 256 TYR HB3 H N N 257 TYR HD1 H N N 258 TYR HD2 H N N 259 TYR HE1 H N N 260 TYR HE2 H N N 261 TYR HH H N N 262 TYR HXT H N N 263 VAL N N N N 264 VAL CA C N S 265 VAL C C N N 266 VAL O O N N 267 VAL CB C N N 268 VAL CG1 C N N 269 VAL CG2 C N N 270 VAL OXT O N N 271 VAL H H N N 272 VAL H2 H N N 273 VAL HA H N N 274 VAL HB H N N 275 VAL HG11 H N N 276 VAL HG12 H N N 277 VAL HG13 H N N 278 VAL HG21 H N N 279 VAL HG22 H N N 280 VAL HG23 H N N 281 VAL HXT H N N 282 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 ILE N CA sing N N 111 ILE N H sing N N 112 ILE N H2 sing N N 113 ILE CA C sing N N 114 ILE CA CB sing N N 115 ILE CA HA sing N N 116 ILE C O doub N N 117 ILE C OXT sing N N 118 ILE CB CG1 sing N N 119 ILE CB CG2 sing N N 120 ILE CB HB sing N N 121 ILE CG1 CD1 sing N N 122 ILE CG1 HG12 sing N N 123 ILE CG1 HG13 sing N N 124 ILE CG2 HG21 sing N N 125 ILE CG2 HG22 sing N N 126 ILE CG2 HG23 sing N N 127 ILE CD1 HD11 sing N N 128 ILE CD1 HD12 sing N N 129 ILE CD1 HD13 sing N N 130 ILE OXT HXT sing N N 131 LEU N CA sing N N 132 LEU N H sing N N 133 LEU N H2 sing N N 134 LEU CA C sing N N 135 LEU CA CB sing N N 136 LEU CA HA sing N N 137 LEU C O doub N N 138 LEU C OXT sing N N 139 LEU CB CG sing N N 140 LEU CB HB2 sing N N 141 LEU CB HB3 sing N N 142 LEU CG CD1 sing N N 143 LEU CG CD2 sing N N 144 LEU CG HG sing N N 145 LEU CD1 HD11 sing N N 146 LEU CD1 HD12 sing N N 147 LEU CD1 HD13 sing N N 148 LEU CD2 HD21 sing N N 149 LEU CD2 HD22 sing N N 150 LEU CD2 HD23 sing N N 151 LEU OXT HXT sing N N 152 LYS N CA sing N N 153 LYS N H sing N N 154 LYS N H2 sing N N 155 LYS CA C sing N N 156 LYS CA CB sing N N 157 LYS CA HA sing N N 158 LYS C O doub N N 159 LYS C OXT sing N N 160 LYS CB CG sing N N 161 LYS CB HB2 sing N N 162 LYS CB HB3 sing N N 163 LYS CG CD sing N N 164 LYS CG HG2 sing N N 165 LYS CG HG3 sing N N 166 LYS CD CE sing N N 167 LYS CD HD2 sing N N 168 LYS CD HD3 sing N N 169 LYS CE NZ sing N N 170 LYS CE HE2 sing N N 171 LYS CE HE3 sing N N 172 LYS NZ HZ1 sing N N 173 LYS NZ HZ2 sing N N 174 LYS NZ HZ3 sing N N 175 LYS OXT HXT sing N N 176 PHE N CA sing N N 177 PHE N H sing N N 178 PHE N H2 sing N N 179 PHE CA C sing N N 180 PHE CA CB sing N N 181 PHE CA HA sing N N 182 PHE C O doub N N 183 PHE C OXT sing N N 184 PHE CB CG sing N N 185 PHE CB HB2 sing N N 186 PHE CB HB3 sing N N 187 PHE CG CD1 doub Y N 188 PHE CG CD2 sing Y N 189 PHE CD1 CE1 sing Y N 190 PHE CD1 HD1 sing N N 191 PHE CD2 CE2 doub Y N 192 PHE CD2 HD2 sing N N 193 PHE CE1 CZ doub Y N 194 PHE CE1 HE1 sing N N 195 PHE CE2 CZ sing Y N 196 PHE CE2 HE2 sing N N 197 PHE CZ HZ sing N N 198 PHE OXT HXT sing N N 199 PRO N CA sing N N 200 PRO N CD sing N N 201 PRO N H sing N N 202 PRO CA C sing N N 203 PRO CA CB sing N N 204 PRO CA HA sing N N 205 PRO C O doub N N 206 PRO C OXT sing N N 207 PRO CB CG sing N N 208 PRO CB HB2 sing N N 209 PRO CB HB3 sing N N 210 PRO CG CD sing N N 211 PRO CG HG2 sing N N 212 PRO CG HG3 sing N N 213 PRO CD HD2 sing N N 214 PRO CD HD3 sing N N 215 PRO OXT HXT sing N N 216 SER N CA sing N N 217 SER N H sing N N 218 SER N H2 sing N N 219 SER CA C sing N N 220 SER CA CB sing N N 221 SER CA HA sing N N 222 SER C O doub N N 223 SER C OXT sing N N 224 SER CB OG sing N N 225 SER CB HB2 sing N N 226 SER CB HB3 sing N N 227 SER OG HG sing N N 228 SER OXT HXT sing N N 229 TYR N CA sing N N 230 TYR N H sing N N 231 TYR N H2 sing N N 232 TYR CA C sing N N 233 TYR CA CB sing N N 234 TYR CA HA sing N N 235 TYR C O doub N N 236 TYR C OXT sing N N 237 TYR CB CG sing N N 238 TYR CB HB2 sing N N 239 TYR CB HB3 sing N N 240 TYR CG CD1 doub Y N 241 TYR CG CD2 sing Y N 242 TYR CD1 CE1 sing Y N 243 TYR CD1 HD1 sing N N 244 TYR CD2 CE2 doub Y N 245 TYR CD2 HD2 sing N N 246 TYR CE1 CZ doub Y N 247 TYR CE1 HE1 sing N N 248 TYR CE2 CZ sing Y N 249 TYR CE2 HE2 sing N N 250 TYR CZ OH sing N N 251 TYR OH HH sing N N 252 TYR OXT HXT sing N N 253 VAL N CA sing N N 254 VAL N H sing N N 255 VAL N H2 sing N N 256 VAL CA C sing N N 257 VAL CA CB sing N N 258 VAL CA HA sing N N 259 VAL C O doub N N 260 VAL C OXT sing N N 261 VAL CB CG1 sing N N 262 VAL CB CG2 sing N N 263 VAL CB HB sing N N 264 VAL CG1 HG11 sing N N 265 VAL CG1 HG12 sing N N 266 VAL CG1 HG13 sing N N 267 VAL CG2 HG21 sing N N 268 VAL CG2 HG22 sing N N 269 VAL CG2 HG23 sing N N 270 VAL OXT HXT sing N N 271 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' 900 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2MOF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_